CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_MOUSE (Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.222e-25
Identity = 57/142 (40.14%), Postives = 84/142 (59.15%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A  G PE  L  IPGAGGTQRL R VGKS+A +++ TG ++S +DA   GLV+   P  +   +A++ A++I     I + MAK ++    E+ +    +LE+  +  T  T+DR EG+ AF EKRK  +
Sbjct:  146 AMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANF 287          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_RAT (Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.902e-25
Identity = 57/142 (40.14%), Postives = 85/142 (59.86%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A  G PE  L  IPGAGGTQRL R VGKS+A +++ TG ++S +DA   GLV+   P      +A++ A++I     I + MAK ++    E+ +    +LE++ +  T  T+DR EG++AF EKRK  +
Sbjct:  146 AMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF 287          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: PAAF_ECOLI (Probable enoyl-CoA hydratase paaF OS=Escherichia coli (strain K12) GN=paaF PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 6.466e-25
Identity = 58/144 (40.28%), Postives = 89/144 (61.81%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            AL CD+ + GE A  GLPE  L I+PGAGGTQRL R VGKS+A  ++ +G  ++ + A   GLV+   P+      AL++A ++ +  P+A++ AK+A+ +  EV + + L  E + +     TEDR EG++AF +KR P + G
Sbjct:  111 ALLCDVVVAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKRTPDFKG 254          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_HUMAN (Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4)

HSP 1 Score: 111.309 bits (277), Expect = 1.881e-24
Identity = 55/142 (38.73%), Postives = 83/142 (58.45%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A    PE  +  IPGAGGTQRL R VGKS+A +++ TG ++S +DA   GLV+   P      +A++ A++I     I + MAK ++    E+ +    +LE++ +  T  T+DR EG+ AF EKRK  +
Sbjct:  146 AMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANF 287          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHA8_MYCTU (Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis GN=echA8 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.457e-24
Identity = 58/143 (40.56%), Postives = 81/143 (56.64%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYT 430
            A+ CD+ I  + A  G PE  L ++PG GG+QRL R +GK+ A D+I TGR +   +A   GLV+  VPA     +A   A  I+Q    A RMAK A+ +  E  ++  L  E   +     TED+ EG+AAF EKR P++T
Sbjct:  113 AMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFT 255          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHA8_MYCBO (Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis GN=echA8 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.457e-24
Identity = 58/143 (40.56%), Postives = 81/143 (56.64%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYT 430
            A+ CD+ I  + A  G PE  L ++PG GG+QRL R +GK+ A D+I TGR +   +A   GLV+  VPA     +A   A  I+Q    A RMAK A+ +  E  ++  L  E   +     TED+ EG+AAF EKR P++T
Sbjct:  113 AMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFT 255          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_PONAB (Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.191e-24
Identity = 56/142 (39.44%), Postives = 82/142 (57.75%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A    PE  +  IPGAGGTQRL R VGKS+A +++ TG ++S +DA   GLV+   P      +A++ A++I     I   MAK ++    E+ +A   +LE++ +  T  T DR EG+ AF EKRK  +
Sbjct:  146 AMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRTVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIIAAMAKESVNAAFEMTLAEGSKLEKKLFYSTFATNDRKEGMTAFVEKRKANF 287          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHA8_MYCLE (Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae GN=echA8 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 5.474e-24
Identity = 59/143 (41.26%), Postives = 82/143 (57.34%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYT 430
            A+ CDL I  + A  G PE  L ++PG GG+QRL R +GK+ A D+I TGR +   +A   GLV+  V A     +A  +A  I+Q    A RMAK A+ +  E  +A  L  E   +  T  T+D+ EG+AAF EKR P++T
Sbjct:  113 AMMCDLLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVVLADDLLPEAKAVATTISQMSRSATRMAKEAVNRSFESTLAEGLLHERRLFHSTFVTDDQSEGMAAFIEKRAPQFT 255          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_DICDI (Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.634e-23
Identity = 53/142 (37.32%), Postives = 80/142 (56.34%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+ I GE A+ G PE  L  IPG GGTQRL R +GKS A +++ TG  ++  +A   GLV+  VP  +   +A ++A++I     + + MAK A+    E+ +   +  E   +  T  T D+ EG+ AF EKR P +
Sbjct:  133 AMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGKSKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVNASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTW 274          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHH_RHIME (Probable enoyl-CoA hydratase OS=Rhizobium meliloti GN=fadB1 PE=3 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 3.923e-22
Identity = 58/142 (40.85%), Postives = 79/142 (55.63%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD  I  E A  G PE  L +IPG GG+QRL R VGK+ A D+I TGR +   +A   GLV+  V   +   +AL  A++I      A  MAK A+ + LE+ +A  L  E   +     TED+ EG+AAF  KRK ++
Sbjct:  113 AMMCDFIIASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAPDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQKEGMAAFVAKRKAEF 254          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
ECHM_MOUSE2.222e-2540.14Enoyl-CoA hydratase, mitochondrial OS=Mus musculus... [more]
ECHM_RAT2.902e-2540.14Enoyl-CoA hydratase, mitochondrial OS=Rattus norve... [more]
PAAF_ECOLI6.466e-2540.28Probable enoyl-CoA hydratase paaF OS=Escherichia c... [more]
ECHM_HUMAN1.881e-2438.73Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens... [more]
ECHA8_MYCTU2.457e-2440.56Probable enoyl-CoA hydratase echA8 OS=Mycobacteriu... [more]
ECHA8_MYCBO2.457e-2440.56Probable enoyl-CoA hydratase echA8 OS=Mycobacteriu... [more]
ECHM_PONAB4.191e-2439.44Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii... [more]
ECHA8_MYCLE5.474e-2441.26Probable enoyl-CoA hydratase echA8 OS=Mycobacteriu... [more]
ECHM_DICDI4.634e-2337.32Probable enoyl-CoA hydratase, mitochondrial OS=Dic... [more]
ECHH_RHIME3.923e-2240.85Probable enoyl-CoA hydratase OS=Rhizobium meliloti... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top