CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ENT38 (Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.556e-15
Identity = 42/88 (47.73%), Postives = 60/88 (68.18%), Query Frame = 2
Query:    2 ALACDLRICGEAA--LLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQ 259
            ALAC  R+C + A  +LGLPE  L ++PG+GGTQRLPRLVG S A ++I TG+++  + A+ +GLV+  VP       A+E+AQ+  Q
Sbjct:  120 ALACHSRVCTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRPRQALKVGLVDEVVPHSILLTAAVELAQKERQ 207          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_VIBCH (Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae GN=fadJ PE=3 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 4.644e-15
Identity = 39/71 (54.93%), Postives = 50/71 (70.42%), Query Frame = 2
Query:    2 ALACDLRIC--GEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVP 208
            ALACD R+C   E   LGLPE  L ++PG+GGTQRLPRL+G   A D+I TG+++  K A  LG+V+ CVP
Sbjct:  121 ALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLPALDLILTGKQLRAKKAKKLGVVDACVP 191          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_VIBC3 (Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=fadJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.644e-15
Identity = 39/71 (54.93%), Postives = 50/71 (70.42%), Query Frame = 2
Query:    2 ALACDLRIC--GEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVP 208
            ALACD R+C   E   LGLPE  L ++PG+GGTQRLPRL+G   A D+I TG+++  K A  LG+V+ CVP
Sbjct:  121 ALACDYRVCTEDEVTRLGLPEVMLGLLPGSGGTQRLPRLIGLLPALDLILTGKQLRAKKAKKLGVVDACVP 191          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHEB8 (Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.644e-15
Identity = 44/101 (43.56%), Postives = 63/101 (62.38%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAI 298
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+K+  K A+ +GLVN  VP    Q   L+ A E+   G  A +  K+++
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKKIRPKQALKMGLVNDVVP----QTILLQTAVEMALAGKRAPKPVKKSL 214          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOSM (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.644e-15
Identity = 44/96 (45.83%), Postives = 63/96 (65.62%), Query Frame = 2
Query:    2 ALACDLRICGEAA--LLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C + A  +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO7I (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.644e-15
Identity = 44/96 (45.83%), Postives = 63/96 (65.62%), Query Frame = 2
Query:    2 ALACDLRICGEAA--LLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C + A  +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_CITK8 (Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 6.066e-15
Identity = 48/95 (50.53%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGEAA--LLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC + A  +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  K A+ +GLV+  VP        LE A E+  KG  A R
Sbjct:  120 ALACHRRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRPKQALRVGLVDEVVP----HAILLEAAVELAIKGRSAQR 210          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_VIBHB (Fatty acid oxidation complex subunit alpha OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 42/90 (46.67%), Postives = 60/90 (66.67%), Query Frame = 2
Query:    2 ALACDLRICGEA--ALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKG 265
            ALACD R+C ++    LGLPE  L ++PG+GGTQRLPRL+G   + D+I TG+++  K A  LG+V+ CVP    +   L+IA+   +KG
Sbjct:  120 ALACDYRVCTDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAKKLGVVDACVP----ETVLLDIAKMHVEKG 205          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SHESW (Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAI 298
            ALAC  R+C +    +LG+PE  L ++PG GGTQRLPRLVG + A D++ TG+++  K A+ +GLVN  VP    Q   L+ A E+   G  A +  K+++
Sbjct:  118 ALACHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRSKQALKMGLVNDVVP----QTILLQTAVEMALTGKRAPKPVKKSL 214          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_SALTY (Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium GN=fadJ PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.922e-15
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIR 280
            ALAC  RIC +    +LGLPE  L ++PG+GGTQRLPRLVG S A D+I TG+++  + A+  GLV+  VP    Q   LE A E+ +K  +A R
Sbjct:  120 ALACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVP----QTILLEAAVELAKKERLAQR 210          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADJ_ENT383.556e-1547.73Fatty acid oxidation complex subunit alpha OS=Ente... [more]
FADJ_VIBCH4.644e-1554.93Fatty acid oxidation complex subunit alpha OS=Vibr... [more]
FADJ_VIBC34.644e-1554.93Fatty acid oxidation complex subunit alpha OS=Vibr... [more]
FADJ_SHEB84.644e-1543.56Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_ECOSM4.644e-1545.83Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO7I4.644e-1545.83Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_CITK86.066e-1550.53Fatty acid oxidation complex subunit alpha OS=Citr... [more]
FADJ_VIBHB7.922e-1546.67Fatty acid oxidation complex subunit alpha OS=Vibr... [more]
FADJ_SHESW7.922e-1542.57Fatty acid oxidation complex subunit alpha OS=Shew... [more]
FADJ_SALTY7.922e-1548.42Fatty acid oxidation complex subunit alpha OS=Salm... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top