CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOUT (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOLU (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRMCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOLI (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A +E     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOL5 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOK1 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECODH (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A +E     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECOBW (Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / BW2952) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A +E     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO81 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO45 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: FADJ_ECO27 (Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:    2 ALACDLRICGE--AALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIA-QEINQKGPIAIR 280
            ALAC  R+C +    +LGLPE  L ++PG+GGTQRLPRL+G S A ++I TG+++  K A+ LGLV+  VP       A+E+A Q+     P+ +R
Sbjct:  120 ALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVR 215          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
FADJ_ECOUT1.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECOLU1.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECOLI1.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECOL51.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECOK11.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECODH1.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECOBW1.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO811.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO451.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]
FADJ_ECO271.765e-1444.79Fatty acid oxidation complex subunit alpha OS=Esch... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top