CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_DICDI (Sumo-conjugating enzyme ubc9 OS=Dictyostelium discoideum GN=ubc9 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N++ W+  I G   T +EGG +  IM F ++YP  PP  RF  + +HPNVYP G VC+SIL+   D
Sbjct:   37 NLYVWNCGIPGKTKTNWEGGVYPLIMEFTEDYPSKPPKCRFPKDFFHPNVYPSGTVCLSILNEEAD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG   + ++F+W A+I+GP D+ + GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQRDPPVSCSAGPTGD-DMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_XENTR (SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis GN=ube2i PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_XENLA (SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=ube2i PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_SPETR (SUMO-conjugating enzyme UBC9 OS=Spermophilus tridecemlineatus GN=UBE2I PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_RAT (SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus GN=Ube2i PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_MOUSE (SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ube2i PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_MESAU (SUMO-conjugating enzyme UBC9 OS=Mesocricetus auratus GN=UBE2I PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_HUMAN (SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UBE2I PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_CHICK (SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=UBE2I PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+  W  +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC9_DICDI1.777e-1245.45Sumo-conjugating enzyme ubc9 OS=Dictyostelium disc... [more]
UBC30_ARATH1.777e-1239.24Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC9_XENTR3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis... [more]
UBC9_XENLA3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=... [more]
UBC9_SPETR3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Spermophilus tride... [more]
UBC9_RAT3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus ... [more]
UBC9_MOUSE3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ub... [more]
UBC9_MESAU3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Mesocricetus aurat... [more]
UBC9_HUMAN3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UB... [more]
UBC9_CHICK3.031e-1246.97SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=U... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top