CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.504e-11
Identity = 31/79 (39.24%), Postives = 50/79 (63.29%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            +L ++P    SAG   E ++F W A+I+GP ++ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 ELQRDPPVSCSAGPTGE-DMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2K_MOUSE (Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=2 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 3.351e-11
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = -2
Query:   58 LVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYP-DGKVCISIL 255
            LVDE N  E    I GPPDT YEGG +   +  P+ YP +PP VRF +++WHPN+    G +C+ IL
Sbjct:   31 LVDE-NFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDIL 96          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2K_HUMAN (Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 3.351e-11
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = -2
Query:   58 LVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYP-DGKVCISIL 255
            LVDE N  E    I GPPDT YEGG +   +  P+ YP +PP VRF +++WHPN+    G +C+ IL
Sbjct:   31 LVDE-NFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDIL 96          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2K_BOVIN (Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 3.351e-11
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = -2
Query:   58 LVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYP-DGKVCISIL 255
            LVDE N  E    I GPPDT YEGG +   +  P+ YP +PP VRF +++WHPN+    G +C+ IL
Sbjct:   31 LVDE-NFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDIL 96          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2N_MACFA (Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.465e-11
Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L   PV G  A   DESN   +   I GP D+ +EGG F   +  P+ YP++ P VRF ++++HPNV   G++C+ IL
Sbjct:   15 LLAEPVPGIKAE-PDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKSGRICLDIL 91          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2N_DROME (Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.465e-11
Identity = 29/78 (37.18%), Postives = 50/78 (64.10%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L + PV G +A + DE+N   +   + GP D+ +EGG F   +  P++YP+S P VRF ++++HPN+   G++C+ +L
Sbjct:   15 LMQEPVPGINA-IPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVL 91          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2T_XENLA (Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.750e-11
Identity = 28/67 (41.79%), Postives = 42/67 (62.69%), Query Frame = -2
Query:   49 DESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPP 249
            +ESN+ +  A IIG   + YEGG FN  +  P+ YP  PP +RF + ++HPN+   G++C+ IL  P
Sbjct:   27 NESNMDDLRAQIIGGSGSPYEGGIFNLEIIVPERYPFEPPKIRFLTPIYHPNIDSAGRICLDILKLP 93          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBCB_DICDI (Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.750e-11
Identity = 30/79 (37.97%), Postives = 50/79 (63.29%), Query Frame = -2
Query:   61 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNV-YPDGKVCISI 294
            D+ K P    SA LVD+ N+ +W A++ GP  + +E G F+  +  P +YP  PPT++FT++++HPN+   DG +C  +
Sbjct:   13 DMLKTPPSWCSAHLVDD-NLQKWKATVQGPEGSPFEKGVFSMDIDIPADYPFKPPTLKFTTKIYHPNIKTSDGAICAEV 90          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_PAGMA (SUMO-conjugating enzyme UBC9 OS=Pagrus major GN=ube2i PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.750e-11
Identity = 30/66 (45.45%), Postives = 38/66 (57.58%), Query Frame = -2
Query:   43 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGD 240
            N+     +I G   T +EGG F   M F D+YP SPP  +F   ++HPNVYP G VC+SIL    D
Sbjct:   37 NLMNGECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC29_ARATH1.504e-1139.24Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBE2K_MOUSE3.351e-1147.76Ubiquitin-conjugating enzyme E2 K OS=Mus musculus ... [more]
UBE2K_HUMAN3.351e-1147.76Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens ... [more]
UBE2K_BOVIN3.351e-1147.76Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN... [more]
UBE2N_MACFA7.465e-1141.03Ubiquitin-conjugating enzyme E2 N OS=Macaca fascic... [more]
UBE2N_DROME7.465e-1137.18Ubiquitin-conjugating enzyme E2 N OS=Drosophila me... [more]
UBE2T_XENLA9.750e-1141.79Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevi... [more]
UBCB_DICDI9.750e-1137.97Ubiquitin conjugating enzyme E2 B OS=Dictyostelium... [more]
UBC9_PAGMA9.750e-1145.45SUMO-conjugating enzyme UBC9 OS=Pagrus major GN=ub... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top