CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.522e-15
Identity = 37/78 (47.44%), Postives = 49/78 (62.82%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+  W+A I GP  T +E G F   + F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 8.522e-15
Identity = 37/78 (47.44%), Postives = 49/78 (62.82%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L ++P  G S G   E+N+  W+A I GP  T +E G F   + F + YP  PPTVRF S+M+HPNVY DG +C+ IL
Sbjct:   16 LQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.522e-15
Identity = 35/79 (44.30%), Postives = 53/79 (67.09%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GPPD+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLGRDPPAQCSAGPVGD-DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_TRIHA (Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.522e-15
Identity = 36/75 (48.00%), Postives = 50/75 (66.67%), Query Frame = -2
Query:   58 NPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 282
            +P  G SA  + + NV  W+A IIGP DT +E G F  +M F + YP  PP V+F S+M+HPNVY +G++C+ IL
Sbjct:   19 DPPAGVSASPIPD-NVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISQMFHPNVYANGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_USTMA (Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.454e-14
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L  +P  G S G     N+  W+A I GP DT +E G F  ++TF ++YP  PPTV+F S+M+HPNVY +G++C+ IL
Sbjct:   16 LSTDPPGGIS-GAPCADNLMIWNAVIFGPADTPFEDGTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_SCHPO (Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe GN=rhp6 PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 1.454e-14
Identity = 36/76 (47.37%), Postives = 51/76 (67.11%), Query Frame = -2
Query:   58 KNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 285
            ++P  G SA  V + NV  W+A IIGP DT +E G F  +++F + YP  PP V+F S M+HPNVY +G++C+ IL
Sbjct:   18 QDPPAGVSASPVSD-NVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_YARLI (Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica GN=UBC2 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 35/76 (46.05%), Postives = 50/76 (65.79%), Query Frame = -2
Query:   58 KNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 285
            ++P  G SA  V + NV  W+A IIGP +T +E G F  ++ F + YP  PP V+F S+M+HPNVY  G++C+ IL
Sbjct:   18 QDPPQGVSASPVAD-NVLTWNAVIIGPAETPFEDGTFRMVLQFDEQYPNKPPAVKFVSQMFHPNVYSSGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC2_DEBHA (Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -2
Query:   58 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 240
            NV  W+A IIGP DT +E G F  I+ F + YP  PP+V+F SEM+HPNVY  G++C+ IL
Sbjct:   32 NVMSWNAVIIGPADTPFEDGTFRLILQFDEQYPNKPPSVKFISEMFHPNVYASGELCLDIL 92          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V E ++F W A+I+GP D+ Y GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLGRDPPSSCSAGPVGE-DLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC1_COLGL (Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V E ++F W A+I+GP D+ Y GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLGRDPPSSCSAGPVGE-DLFHWQATIMGPGDSPYSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDIL 89          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBE2A_MOUSE8.522e-1547.44Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN8.522e-1547.44Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]
UBCD1_DROME8.522e-1544.30Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC2_TRIHA8.522e-1548.00Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma h... [more]
UBC2_USTMA1.454e-1446.15Ubiquitin-conjugating enzyme E2 2 OS=Ustilago mayd... [more]
UBC2_SCHPO1.454e-1447.37Ubiquitin-conjugating enzyme E2 2 OS=Schizosacchar... [more]
UBC2_YARLI1.898e-1446.05Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipo... [more]
UBC2_DEBHA1.898e-1454.10Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces ... [more]
UBC1_MAGGR1.898e-1444.30Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
UBC1_COLGL1.898e-1444.30Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top