CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC12_ARATH (Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.238e-14
Identity = 32/79 (40.51%), Postives = 49/79 (62.03%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            D+ ++P    SAG V E ++F W A+I+GP D+ Y GG F   + F  +YP  PP V F ++++HPN+   G +C+ IL
Sbjct:   12 DMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDIL 90          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 36/79 (45.57%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GP D+ Y GG F   + FP +YP  PP V F ++++HPNV  +G +C+ IL
Sbjct:   12 DLQKDPPTSCSAGPVAE-DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_RAT (Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_PONAB (Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_MOUSE (Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_MACFA (Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_HUMAN (Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_XENLA (Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_RAT (Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D2_PIG (Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.229e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +G +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 89          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC12_ARATH3.238e-1440.51Probable ubiquitin-conjugating enzyme E2 12 OS=Ara... [more]
UBC28_ARATH4.229e-1445.57Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UB2D3_RAT4.229e-1443.04Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norve... [more]
UB2D3_PONAB4.229e-1443.04Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii... [more]
UB2D3_MOUSE4.229e-1443.04Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus... [more]
UB2D3_MACFA4.229e-1443.04Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fasci... [more]
UB2D3_HUMAN4.229e-1443.04Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens... [more]
UB2D2_XENLA4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laev... [more]
UB2D2_RAT4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norve... [more]
UB2D2_PIG4.229e-1443.04Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top