CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_SCHPO (SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyces pombe GN=hus5 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.607e-13
Identity = 30/62 (48.39%), Postives = 39/62 (62.90%), Query Frame = -2
Query:   55 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILH 240
            ++  W   I G P T +EGG +   M FP+ YP  PP  RFT  ++HPNVYP G VC+SIL+
Sbjct:   37 DLMNWKVGIPGKPKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILN 98          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.607e-13
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GP ++ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQKDPPTSCSAGPVAE-DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC11_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC11 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.099e-13
Identity = 33/78 (42.31%), Postives = 44/78 (56.41%), Query Frame = -2
Query:   58 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 291
            L  +  +  SA  VD++++  W   I GP DT Y G  F   + FP NYP  PP ++F S MWHPNV   G +C+ IL
Sbjct:   20 LLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDIL 97          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.099e-13
Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL K+P    SAG V E ++F W A+I+GP ++ Y GG F   + FP +YP  PP V F ++++HPN+  +G +C+ IL
Sbjct:   12 DLQKDPPTSCSAGPVAE-DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC21_ARATH (Probable ubiquitin carrier protein E2 21 OS=Arabidopsis thaliana GN=UBC21 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.741e-13
Identity = 30/67 (44.78%), Postives = 48/67 (71.64%), Query Frame = -2
Query:   58 LVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNV-YPDGKVCISIL 255
            + D++N+F+W+A I GP +T YEGG F    + P+ YP+ PP VRF ++++HPNV +  G++C+ IL
Sbjct:   28 ICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDIL 94          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2D3_BOVIN (Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.741e-13
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = -2
Query:   58 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 294
            DL ++P    SAG V + ++F W A+I+GP D+ Y+GG F   + FP +YP  PP V FT+ ++HPN+  +  +C+ IL
Sbjct:   12 DLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNDSICLDIL 89          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBE2C_SPISO (Ubiquitin-conjugating enzyme E2 C OS=Spisula solidissima GN=UBE2C PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.580e-13
Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = -2
Query:   58 DESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 249
            D  N+F+W A++ GP DT+YE   +   + FP +YP  PP V+FT+  WHPNV   G +C+ IL
Sbjct:   55 DGDNLFKWVATLDGPKDTVYESLKYKLTLEFPSDYPYKPPVVKFTTPCWHPNVDQSGNICLDIL 118          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBCX_DICDI (Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostelium discoideum GN=pex4 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.580e-13
Identity = 29/65 (44.62%), Postives = 47/65 (72.31%), Query Frame = -2
Query:   58 DESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNV-YPDGKVCISIL 249
            DES+++ W A I GPPDT YE G F   ++ P NYP+ PPT++F ++++HPN+ +  G++C+ +L
Sbjct:   26 DESDLYRWVAIIKGPPDTPYENGKFELDISVPTNYPLQPPTIKFVTKIFHPNIHFKTGEICLDLL 90          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC31_ARATH (Probable ubiquitin carrier protein E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.580e-13
Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = -2
Query:    1 FSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 267
            FS G  + +N++EW+A I GP  T YEGG FN  + FP +YP  PP   F + ++HPN+  +G +C++IL              ++WTP
Sbjct:   27 FSIGQ-NSNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNIL-------------KDKWTP 101          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC9_CAEEL (SUMO-conjugating enzyme UBC9 OS=Caenorhabditis elegans GN=ubc-9 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.361e-12
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = -2
Query:   58 NVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISIL 240
            N+F W  +I G  DT++EGG +   M F D++P +PP  +F   ++HPNVYP G VC+S+L
Sbjct:   37 NLFNWECAIPGRKDTIWEGGLYRIRMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLL 97          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UBC9_SCHPO1.607e-1348.39SUMO-conjugating enzyme ubc9 OS=Schizosaccharomyce... [more]
UBC8_ARATH1.607e-1343.04Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC11_YEAST2.099e-1342.31Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBC10_ARATH2.099e-1343.04Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC21_ARATH2.741e-1344.78Probable ubiquitin carrier protein E2 21 OS=Arabid... [more]
UB2D3_BOVIN2.741e-1341.77Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus G... [more]
UBE2C_SPISO3.580e-1345.31Ubiquitin-conjugating enzyme E2 C OS=Spisula solid... [more]
UBCX_DICDI3.580e-1344.62Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostel... [more]
UBC31_ARATH3.580e-1338.20Probable ubiquitin carrier protein E2 31 OS=Arabid... [more]
UBC9_CAEEL1.361e-1245.90SUMO-conjugating enzyme UBC9 OS=Caenorhabditis ele... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top