DY258284

Overview
NameDY258284
Unique NameDY258284
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1315
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1067 contig Ccv1_Contig1067:1..1315. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: Y5169_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 97/237 (40.93%), Postives = 144/237 (60.76%), Query Frame = 3
Query:  144 KRFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY-KDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQRAFDLAMLANDENVMLLDRVK 851
            +R +  E+ + T+ F  + ++G GGFG VY G L D + VAVK L    +S G  +F+ EV+++    H NL+ L G+C       L+Y YMANG + S L  +      L W  R  IA+ +A GL YLH  C P ++HRDVK+ NILLDE F+A + DFGL++     +++H++T V GT G++ PEY  T R +EK+DV+ +GI+LLE+IT Q   + A    +EN  + +RV+
Sbjct:  561 RRITYSEILLMTNNF--ERVIGEGGFGVVYHGYLNDSEQVAVKVLSPS-SSQGYKEFKAEVELLLRVHHINLVSLVGYCDEQAHLALIYEYMANGDLKSHLSGKHGDCV-LKWENRLSIAVETALGLEYLHSGCKPLMVHRDVKSMNILLDEHFQAKLADFGLSRSFSVGEESHVSTGVVGTPGYLDPEYYRTYRLTEKSDVYSFGIVLLEIITNQPVLEQA----NENRHIAERVR 789          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: Y5005_ARATH (Probable receptor-like protein kinase At5g20050 OS=Arabidopsis thaliana GN=At5g20050 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 97/224 (43.30%), Postives = 143/224 (63.84%), Query Frame = 3
Query:  147 RFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTE---KLLVYRYMANGSV-----ASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQRA 794
            +F L +L+ ATDGF  ++++G+GG G V+KG L DG  VAVKR++ E    GE +F++EV  I+   H+NL+ L G+ ++ +    + LVY Y+ N S+       R    +S    L W  R ++A+  A+ L+YLH  C  KI+H DVK  NILLDE F AVV DFGL+KL+   ++ + T + GT G++APE+L     SEK+DV+ YGI+LLE+I G+R+
Sbjct:   92 KFKLEDLEEATDGF--RSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEK--GEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRS 311          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: WAKLG_ARATH (Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 101/262 (38.55%), Postives = 148/262 (56.49%), Query Frame = 3
Query:  132 LGQLKRFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQR--------------AFDLAMLANDENVMLLD-RVKGYPXREE 872
            + + K FS  +L+ ATD F+   ILG+GG G VYKG L DG +VAVK+ K  +    E +F  E+ ++S   HRN++ + G C      +LVY ++ N ++   L       P + W  R  IA   A  LSYLH      I HRDVK+ NILLDE+  A V DFG+++ +   DTH+TT V GT+G++ PEYL +   + K+DV+ +G++L+EL+TG++              A+ L  + ND    +LD R+K    REE
Sbjct:  372 VNRTKVFSSNDLENATDRFNASRILGQGGQGTVYKGMLEDGMIVAVKKSKALKEENLE-EFINEIILLSQINHRNVVKILGCCLETEVPILVYEFIPNRNLFDHLHNPSEDFP-MSWEVRLCIACEVADALSYLHSAVSIPIYHRDVKSTNILLDEKHRAKVSDFGISRSVAIDDTHLTTIVQGTIGYVDPEYLQSNHFTGKSDVYSFGVLLIELLTGEKPVSLLRRQEVRMLGAYFLEAMRNDRLHEILDARIKEECDREE 631          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 92/216 (42.59%), Postives = 131/216 (60.65%), Query Frame = 3
Query:  156 LRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHI-TTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQRAFD 800
            L ++  AT+  ++K ++G+G  G +YK  L+  K+ AVK+L       G +    E++ I    HRNL+ L  F       L++Y YM NGS+   L E      PLDW TR  IA+G+A GL+YLH  CDP I+HRD+K  NILLD + E  + DFG+AKL+D   T I +  V GT+G++APE   T   S ++DV+ YG++LLELIT ++A D
Sbjct:  806 LNKVLEATENLNDKYVIGKGAHGTIYKATLSPDKVYAVKKLVFTGIKNGSVSMVREIETIGKVRHRNLIKLEEFWLRKEYGLILYTYMENGSLHDILHETNPP-KPLDWSTRHNIAVGTAHGLAYLHFDCDPAIVHRDIKPMNILLDSDLEPHISDFGIAKLLDQSATSIPSNTVQGTIGYMAPENAFTTVKSRESDVYSYGVVLLELITRKKALD 1020          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 91/213 (42.72%), Postives = 134/213 (62.91%), Query Frame = 3
Query:  162 ELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQRAFD 800
            ++   T+    K I+G G    VYK      + +A+KR+  +  S    +F+TE++ I    HRN++ L G+  +    LL Y YM NGS+   L      +  LDW TR KIA+G+A+GL+YLH  C P+IIHRD+K++NILLD  FEA + DFG+AK +    T+ +T V GT+G+I PEY  T R +EK+D++ +GI+LLEL+TG++A D
Sbjct:  643 DIMRVTENLDEKYIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFR-EFETELETIGSIRHRNIVSLHGYALSPFGNLLFYDYMENGSLWDLLHGPGKKVK-LDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFGIAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVD 853          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: CRK17_ARATH (Cysteine-rich receptor-like protein kinase 17 OS=Arabidopsis thaliana GN=CRK17 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 95/217 (43.78%), Postives = 141/217 (64.98%), Query Frame = 3
Query:  147 RFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSG-GELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHITTA-VHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQR 791
            +F L+ ++ AT  FS  N LG GGFG+VYKG L +G  +AVKRL   +TSG GE++F+ EV +++   H NL+ L GF     EKLLVY ++ N S+   L +  +    LDW  R+ I  G  RG+ YLH+    KIIHRD+KA+NILLD +    + DFG+A++     T   TA V GT G+++PEY++ G+ S K+DV+ +G+++LE+I+G++
Sbjct:  346 QFDLKTIEAATGNFSEHNKLGAGGFGEVYKGMLLNGTEIAVKRLS--KTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQGEEKLLVYEFVPNKSLDYFLFD-PNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKK 559          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 1.258e-42
Identity = 96/250 (38.40%), Postives = 152/250 (60.80%), Query Frame = 3
Query:   51 IGFAYWRRTRPHEFFFDVPAEDDSELQLGQLKRFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRL--RERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTH-ITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQR 791
            +GF  +RR + ++       E +S++       +  + ++ AT+ FS  N LG GGFG VYKG+L++G  VAVKRL + ++  G  +F+ E  +++   HRNL+ L GFC    E++L+Y ++ N S+   L   E+QS L   DW  R KI  G ARG+ YLH+    KIIHRD+KA+NILLD +    + DFGLA +   + T   T  + GT  +++PEY   G+ S K+D++ +G+++LE+I+G++
Sbjct:  308 LGFVLFRRRKSYQ---RTKTESESDISTTDSLVYDFKTIEAATNKFSTSNKLGEGGFGAVYKGKLSNGTDVAVKRLSK-KSGQGTREFRNEAVLVTKLQHRNLVRLLGFCLEREEQILIYEFVHNKSLDYFLFDPEKQSQL---DWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKK 550          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: RLK6_ARATH (Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.643e-42
Identity = 91/216 (42.13%), Postives = 136/216 (62.96%), Query Frame = 3
Query:  144 KRFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYK-DTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQ 788
            +RF+  E+   T+ F  + +LG+GGFG VY G + + + VAVK L    +S G  +F+ EV+++    H+NL+GL G+C       L+Y YMANG +   +  ++     L+W TR KI + SA+GL YLH  C P ++HRDVK  NILL+E   A + DFGL++    + +TH++T V GT G++ PEY  T   +EK+DV+ +GI+LLE+IT Q
Sbjct:  580 RRFTYSEVVTMTNNF--ERVLGKGGFGMVYHGTVNNTEQVAVKMLSHS-SSQGYKEFKAEVELLLRVHHKNLVGLVGYCDEGENLALIYEYMANGDLREHMSGKRGG-SILNWETRLKIVVESAQGLEYLHNGCKPPMVHRDVKTTNILLNEHLHAKLADFGLSRSFPIEGETHVSTVVAGTPGYLDPEYYRTNWLNEKSDVYSFGIVLLEIITNQ 791          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: ACR4_ARATH (Serine/threonine-protein kinase-like protein ACR4 OS=Arabidopsis thaliana GN=ACR4 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.643e-42
Identity = 96/234 (41.03%), Postives = 145/234 (61.97%), Query Frame = 3
Query:  114 DDSELQLGQLKR-FSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKR-LKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPP-LDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY-KDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQRAFDL 803
            D  ELQ  +  R F+  EL+ A DGF  ++I+G+G F  VYKG L DG  VAVKR +          +F+TE+ ++S   H +LL L G+C    E+LLVY +MA+GS+ + L  +  +L   LDW  R  IA+ +ARG+ YLH +  P +IHRD+K++NIL+DEE  A V DFGL+ L      + +     GT+G++ PEY      + K+DV+ +G++LLE+++G++A D+
Sbjct:  487 DLDELQKRRRARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLRDGTTVAVKRAIMSSDKQKNSNEFRTELDLLSRLNHAHLLSLLGYCEECGERLLVYEFMAHGSLHNHLHGKNKALKEQLDWVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAIDM 720          
BLAST of DY258284 vs. ExPASy Swiss-Prot
Match: WAKLE_ARATH (Wall-associated receptor kinase-like 5 OS=Arabidopsis thaliana GN=WAKL5 PE=2 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 2.146e-42
Identity = 91/226 (40.27%), Postives = 137/226 (60.62%), Query Frame = 3
Query:  114 DDSELQLGQLKRFSLRELQVATDGFSNKNILGRGGFGKVYKGRLADGKLVAVKRLKEERTSGGELQFQTEVKIISMAVHRNLLGLCGFCTTVTEKLLVYRYMANGSVASRLRERQSSLPPLDWPTRKKIALGSARGLSYLHEHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHITTAVHGTVGHIAPEYLSTGRSSEKTDVFGYGIMLLELITGQR 791
            +D  + + +L  FS  EL+ ATD FS K +LG+G  G VYKG + DGK++AVKR K       E +F  E+ ++S   HRN++ L G C      +LVY Y+ NG +  RL +       + W  R +IA+  A  L+Y+H      I HRD+K  NILLDE++ A V DFG ++ +    TH+TT V GT G++ PEY  + + ++K+DV+ +G++L+ELITG++
Sbjct:  410 NDGNVDMSRL--FSSEELKKATDNFSVKRVLGKGSQGTVYKGMMVDGKIIAVKRSKVVDEDKLE-KFINEIILLSQINHRNIVKLIGCCLETEVPILVYEYIPNGDMFKRLHDESDDYA-MTWEVRLRIAIEIAGALTYMHSAASFPIYHRDIKTTNILLDEKYGAKVSDFGTSRSVTIDQTHLTTMVAGTFGYMDPEYFLSSQYTDKSDVYSFGVVLVELITGEK 631          
The following BLAST results are available for this feature:
BLAST of DY258284 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y5169_ARATH1.258e-4240.93Probable LRR receptor-like serine/threonine-protei... [more]
Y5005_ARATH1.258e-4243.30Probable receptor-like protein kinase At5g20050 OS... [more]
WAKLG_ARATH1.258e-4238.55Wall-associated receptor kinase-like 8 OS=Arabidop... [more]
RPK1_IPONI1.258e-4242.59Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
ERL2_ARATH1.258e-4242.72LRR receptor-like serine/threonine-protein kinase ... [more]
CRK17_ARATH1.258e-4243.78Cysteine-rich receptor-like protein kinase 17 OS=A... [more]
CRK11_ARATH1.258e-4238.40Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
RLK6_ARATH1.643e-4242.13Receptor-like protein kinase At3g21340 OS=Arabidop... [more]
ACR4_ARATH1.643e-4241.03Serine/threonine-protein kinase-like protein ACR4 ... [more]
WAKLE_ARATH2.146e-4240.27Wall-associated receptor kinase-like 5 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI1AA05FM2 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258284 ID=DY258284; Name=DY258284; organism=Citrus clementina; type=EST; length=1315bp
TTCCTGTGGGAGTTGCTCTTGGCGCTGCTTTACTTTTTGCTGTACCAGTT
ATTGGGTTTGCATATTGGCGGCGAACAAGACCACACGAATTTTTCTTTGA
CGTACCTGCTGAAGATGATTCAGAACTCCAGTTGGGACAGTTGAAAAGGT
TTTCTTTGCGAGAACTACAAGTTGCTACAGATGGTTTTAGCAACAAGAAC
ATCCTGGGAAGAGGTGGATTTGGCAAGGTGTATAAGGGACGCTTGGCTGA
TGGCAAATTGGTGGCAGTCAAAAGACTTAAGGAAGAGAGGACATCTGGAG
GGGAGTTGCAGTTTCAAACAGAAGTGAAGATAATCAGCATGGCTGTGCAT
CGGAATCTTCTGGGATTATGTGGGTTTTGCACGACTGTCACTGAGAAACT
GCTTGTTTATCGATACATGGCCAATGGAAGTGTTGCATCACGCCTAAGAG
AGCGGCAATCATCACTCCCGCCTCTTGACTGGCCAACTAGGAAGAAAATT
GCTTTAGGTTCAGCGAGGGGCCTTTCATATTTGCACGAGCATTGTGACCC
AAAGATCATTCATCGAGATGTCAAAGCTGCAAACATATTGTTGGATGAAG
AGTTTGAGGCTGTCGTTGGTGACTTTGGTTTAGCTAAACTAATGGACTAC
AAGGACACCCACATAACCACTGCTGTGCATGGCACCGTTGGGCATATAGC
CCCAGAGTATCTCTCCACAGGGAGGTCATCAGAGAAAACGGATGTTTTTG
GTTACGGTATCATGCTGTTAGAGCTAATTACCGGACAAAGGGCATTTGAT
CTTGCTATGCTTGCAAACGATGAAAATGTTATGCTCCTTGATAGAGTTAA
AGGATACCCTANGAGAGAAGAATTTTGATGTACTTGTTGATAAAGACCTG
CCGACTGATTATGAATGAAACTGAAGTGGGAAGAACTCCTCCCAAGTGGC
CCTCCCTTGCCCCCCAACCCCCCCCATCCCACGGGCCCAAAAAAGTCGAA
ATTTGCCAAAATGCTTGAAAGGGCATGGGCTGGGCAAAAAAAAAGGGGGC
AGGGGGGCCAACGGCCGGAGGGTATCCCCCCCCCAAGAAATCTTCATTTG
CCCCACCGGGCAAAAAATTTAAAAAAAAAAAAATTTACCCTCCCCCCCCA
CCCCTTTTTCAAAAATTGCTTTTTTCCCGCGGGCCGCCAAAAAAGAAAAA
GATTTTTTTCCTGTTGGGGCAAACAAAAAGAAAAAACCACCACAACCCCC
CCCTCTTCTCCCCCCTCCCCCCCCCTATTAATTAAGGGAGGGGGGGGTTT
GATTAAACCCCCCCC
back to top