DY258624

Overview
NameDY258624
Unique NameDY258624
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1280
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY258624_ssr132 microsatellite DY258624_ssr132:132..143. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr39 microsatellite DY258624_ssr39:39..50. BLAST: Citrus ESTs to Prunus persica proteins V1
DY258624_ssr781 microsatellite DY258624_ssr781:781..792. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_CHICK (Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_CANFA (Ras-related protein Rab-11A OS=Canis familiaris GN=RAB11A PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 1.518e-77
Identity = 141/192 (73.44%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+S NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_BOVIN (Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3)

HSP 1 Score: 288.115 bits (736), Expect = 7.536e-77
Identity = 140/192 (72.92%), Postives = 166/192 (86.46%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            DD+YDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATRSI+VD K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H+T+ENVERWLKELRDH DSNIVIMLVGNK+DLRHLRAV T++A++FAEK    F+ETSAL+  NVE A   +LT+IYR+V+++ +  R +    P   ++
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDYTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVV 196          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAA2A_ARATH (Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 4.885e-76
Identity = 137/181 (75.69%), Postives = 164/181 (90.61%), Query Frame = 3
Query:  225 AYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREAL 767
            A R D++YDYLFKVVLIGDSGVGKSNLLSRFT+NEF LESKSTIGVEFATR+++V+ + VKAQIWDTAGQERYRAITSAYYRGA+GALLVYDVT+  TFENV RWLKELRDH DSNIVIML+GNK DL+HLRAV+TEDAQS+AEKE   F+ETSALE+LNVE A   +L+++YR+++++++
Sbjct:    2 ARRPDEEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAVATEDAQSYAEKEGLSFIETSALEALNVEKAFQTILSEVYRIISKKSI 182          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB2BV_BETVU (Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 7.054e-75
Identity = 134/191 (70.16%), Postives = 164/191 (85.86%), Query Frame = 3
Query:  225 AYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLP 797
            A R D +YDYLFK+VLIGDSGVGKSN+LSRFT+NEF LESKSTIGVEFATR+++V+ K VKAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+  TF+NV+RWL+ELRDH DSNIVIM+ GNK+DL+HLRAVS ED Q+ AEKE   F+ETSALE++N+E A   +LT+IY +++++AL  ++    LP
Sbjct:    2 ANRVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLKHLRAVSEEDGQALAEKEGLSFLETSALEAVNIEKAFQTILTEIYHIISKKALAAQEASSNLP 192          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11C_LOTJA (Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.126e-72
Identity = 130/185 (70.27%), Postives = 160/185 (86.49%), Query Frame = 3
Query:  225 AYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRD 779
            A+R D +YDYLFK+VLIGDSGVGKSN+LSRFT+NEF LESKSTIGVEFATR+++V+ K VKAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+  TF+NV+RWL+ELRDH DSNIVIM+ GNK+DL HLRAVS +D  + +EKE   F+ETSALE+ N+E A   +LT+IY +V+++AL  ++
Sbjct:    2 AHRVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLNHLRAVSEDDGGALSEKEGLSFLETSALEATNIEKAFQTILTEIYHIVSKKALAAQE 186          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: YPT3_SCHPO (GTP-binding protein ypt3 OS=Schizosaccharomyces pombe GN=ypt3 PE=1 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 3.277e-72
Identity = 134/192 (69.79%), Postives = 162/192 (84.38%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDDPPTLPKGQII 812
            +D+YDYLFK VLIGDSGVGKSNLL RFT+NEF++ESKSTIGVEFATR+I +D+K +KAQIWDTAGQERYRAITSAYYRGAVGAL+VYD+T+  +F+NV RWLKELR+H DSNIVIMLVGNK DL HLRAVSTE+AQ+FA + N  F+ETSA+++ NVE A   VLT+I+R+V+  +LE  DD      GQ +
Sbjct:    4 EDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQTL 195          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAA2C_ARATH (Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4)

HSP 1 Score: 270.781 bits (691), Expect = 1.245e-71
Identity = 129/184 (70.11%), Postives = 157/184 (85.33%), Query Frame = 3
Query:  228 YRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRD 779
            +R D +YDYLFK+VLIGDSGVGKSN+LSRFT+NEF LESKSTIGVEFATR+ +V+ K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+  TF+NV RWL+ELRDH DSNIVIM+ GNK+DL HLR+V+ ED QS AEKE   F+ETSALE+ NVE A   +L +IY +++++AL  ++
Sbjct:    3 HRVDQEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSVAEEDGQSLAEKEGLSFLETSALEATNVEKAFQTILGEIYHIISKKALAAQE 186          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_TOBAC (Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 2.774e-71
Identity = 129/185 (69.73%), Postives = 159/185 (85.95%), Query Frame = 3
Query:  225 AYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRD 779
            A R D +YDYLFK+VLIGDSGVGKSN+LSRFT+NEF LESKSTIGVEFATR+++V+ K VKAQIWDTAGQERYRAITSAYYRGAVGALL YD+T+  TF+NV+RWL+ELRDH DSNIVI+L GNK+DL+HLRAVS +D Q+  +KE   F+ETSALE+LNV+ A   +LT IY +++++AL  ++
Sbjct:    2 ANRVDHEYDYLFKMVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLFYDITKRQTFDNVQRWLRELRDHRDSNIVIILAGNKSDLKHLRAVSEQDDQALVKKEGLSFLETSALEALNVDKAFQTILTDIYHIISKKALAAQE 186          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RGP2_ORYSJ (Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 8.070e-71
Identity = 125/183 (68.31%), Postives = 160/183 (87.43%), Query Frame = 3
Query:  231 RADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRD 779
            R D +Y YLFK+VLIGDSGVGKSN+LSRFT+N FSL+SKSTIGVEFAT+S++++ K +KAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+  +F+NV RWL+ELRDH DS+IVIM+VGNK+DL HLRAVS ++ ++ AEKE  FF+ETSA+E++NVE A   ++T++Y +VNR+AL  ++
Sbjct:    4 RVDHEYSYLFKMVLIGDSGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVIMMVGNKSDLIHLRAVSEDEGKALAEKEGLFFLETSAMEAVNVEEAFQTIITEVYGIVNRKALAAKE 186          
The following BLAST results are available for this feature:
BLAST of DY258624 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RB11A_CHICK1.518e-7773.44Ras-related protein Rab-11A OS=Gallus gallus GN=RA... [more]
RB11A_CANFA1.518e-7773.44Ras-related protein Rab-11A OS=Canis familiaris GN... [more]
RB11A_BOVIN7.536e-7772.92Ras-related protein Rab-11A OS=Bos taurus GN=RAB11... [more]
RAA2A_ARATH4.885e-7675.69Ras-related protein RABA2a OS=Arabidopsis thaliana... [more]
RB2BV_BETVU7.054e-7570.16Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB... [more]
RB11C_LOTJA1.126e-7270.27Ras-related protein Rab11C OS=Lotus japonicus GN=R... [more]
YPT3_SCHPO3.277e-7269.79GTP-binding protein ypt3 OS=Schizosaccharomyces po... [more]
RAA2C_ARATH1.245e-7170.11Ras-related protein RABA2c OS=Arabidopsis thaliana... [more]
RB11A_TOBAC2.774e-7169.73Ras-related protein Rab11A OS=Nicotiana tabacum GN... [more]
RGP2_ORYSJ8.070e-7168.31Ras-related protein RGP2 OS=Oryza sativa subsp. ja... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CG06FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258624 ID=DY258624; Name=DY258624; organism=Citrus clementina; type=EST; length=1280bp
CCCTTCTTAATTTGCAATGTTAATAACATTACTCAAACAAGAAGAAGAAG
AATAGCGAAAGCCTTAGATTTTCTTCATCTGTTCCCATCATCAACTTCAC
CTCACCTGTCTTGCACACACACTCACACTTATCTCTCTCTCTCTATTGCG
TTAATTGCATAATACACAATTCAATAAGAGAGGAGGGGAAAAAAAAAAGA
AGAAAGAAATTGAAAAAAATGGGAGCATACAGAGCTGACGACGACTACGA
TTACTTGTTCAAGGTGGTGTTAATTGGAGATTCAGGAGTTGGGAAATCAA
ATCTGTTATCTCGATTCACCAAGAACGAATTCAGCCTCGAATCGAAATCC
ACCATCGGCGTCGAATTCGCCACTCGCAGCATTCGCGTCGACGACAAGGT
CGTCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAACGATATCGTGCTA
TCACAAGTGCGTACTACCGGGGAGCTGTTGGTGCCTTGCTTGTCTATGAT
GTCACCCGACATGTTACTTTTGAGAATGTTGAGAGATGGTTGAAAGAGCT
TCGGGATCACACAGACTCAAACATTGTGATAATGCTTGTGGGTAACAAGG
CTGATTTGCGTCACTTGCGTGCTGTTTCAACTGAGGATGCTCAGTCGTTC
GCTGAGAAAGAGAACACTTTCTTCATGGAAACCTCTGCCCTAGAGTCGTT
GAATGTTGAAAATGCCCTCCCCGAAGTGCTCACTCAGATATATCGAGTTG
TTAACAGGGAGGCTCTTGAGGTAAGGGATGACCCACCCACCCTGCCCAAG
GGTCAAATTATTATATTGGTACAAAAGATAATGTATCGGCTGTGAAAAAA
ACTGGGTGCTGCTCCTGCATATCCTGCCACCTTCCAAGGAAAATCCCGGG
GGCTAAAAAAAAGTTTCCCCTCTTTTTAAAAATTTAACTTTCCCTTGGTT
TGGAAAAACTCTTGGGTTTTAACTTGGCTGCCCGGAAAAAAAAAAACATG
GGAGGTGCAGGAAAAAAATTTAAGTTTTTACATTTTTCACTCGGGACCCG
GGAAATCTCCCAAATCCTGGGTTGGAAATATAGGGTAAAAAGCCAAAAAT
CTTTTTGGGAATTGGAAAACCCTCCGGGTTTGGTGGGAAGAACCCCACAC
GGTTTTTTTTTTCTTTTTTTGGTGTATTGTCCCTCTTTTGTTTTGTCCCC
CCCCAAAAAAAAAAAATTGGTGAAAAAAAAGTTGTTTTACCCACCCCCCC
CCCCAAAAAACACCCTCCCCAAAAAGAGAA
back to top