DY258624

Overview
NameDY258624
Unique NameDY258624
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1280
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_DICDI (Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 5.413e-67
Identity = 121/175 (69.14%), Postives = 152/175 (86.86%), Query Frame = 3
Query:  234 ADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNR 758
            + ++YDYL+K+VLIGDSGVGKSNLLSRFT+NEFSLE+KSTIGVEFATR+I+ + K +KAQ+WDTAGQERYRAITSAYYRGAVGALLVYD+ +  T+++VERW+ ELR++ D NI IMLVGNK+DLRHLR VST++A+ F+EK    F+ETSAL+S NVE A   +LTQIY +++R
Sbjct:    6 SQEEYDYLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAGQERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLRHLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQNILTQIYHIMSR 180          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RGP1_ORYSJ (Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 1.206e-66
Identity = 122/178 (68.54%), Postives = 151/178 (84.83%), Query Frame = 3
Query:  249 DYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDD 782
            DY+FKVVLIGDS VGKS LL+RF +NEF+L+SK+TIGVEF TR++ +D + VKAQIWDTAGQERYRA+TSAYYRGAVGA+LVYD+T+  +F++V RWL+ELR H D NIVIML+GNK+DL  LR V TEDA+ FAE+EN FFMETSALES NVENA   VLT+IYR+V+++ L   ++
Sbjct:   16 DYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLHIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLGTLRVVPTEDAKEFAERENLFFMETSALESTNVENAFMTVLTEIYRIVSKKNLVANEE 193          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11A_LOTJA (Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.970e-65
Identity = 120/178 (67.42%), Postives = 150/178 (84.27%), Query Frame = 3
Query:  234 ADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREAL 767
            A+   DY+FKVVLIGDS VGKS +L+RF +NEFSL+SKSTIGVEF TR++ +D K VKAQIWDTAGQERYRA+TSAYYRGAVGA+LVYD+T+  TF+++ RWL+ELR+H D NIVI+L+GNK DL + R V TEDA+ FAEKE  FF+ETSALE+ NVE+A   VLT+IY +VN+++L
Sbjct:   10 ANAKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDLVNQRDVPTEDAKEFAEKEGLFFLETSALEATNVESAFTTVLTEIYNIVNKKSL 187          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11D_TOBAC (Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.248e-63
Identity = 117/183 (63.93%), Postives = 148/183 (80.87%), Query Frame = 3
Query:  234 ADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRDD 782
            A    DY+FKVVLIGDS VGKS +L+RF +NEFSL+SK+TIGVEF TR++ +  K VKAQIWDTAGQERYRA+TSAYYRGAVGA+LVYD+T+  TF+++ RWL+ELR H D NIVIML+GNK DL   RAV TEDA+ FA+KE  FF+ETSA+E+ N+E+A   VLT+I+ +VN++ L   D+
Sbjct:    8 ASQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLAIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEATNLEDAFLTVLTEIFNIVNKKNLAADDN 190          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: YPT31_YEAST (GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae GN=YPT31 PE=1 SV=3)

HSP 1 Score: 239.965 bits (611), Expect = 2.354e-62
Identity = 112/179 (62.57%), Postives = 147/179 (82.12%), Query Frame = 3
Query:  243 DYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEVRD 779
            DYD LFK+VLIGDSGVGKSNLLSRFTKNEF+++SKSTIGVEFATR++ +D K +KAQIWDTAGQERYRAITSAYYRGAVGAL+VYD+++  ++EN   WL ELR++ D N+ + L+GNK+DL HLRAV TE++++FA++    F ETSAL S NV+ A  E++  IY+ V++  +++ D
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGD 187          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RB11C_TOBAC (Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.168e-61
Identity = 117/199 (58.79%), Postives = 153/199 (76.88%), Query Frame = 3
Query:  234 ADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREAL-----EVRDDPPTLPKGQIII 815
            A    DY+FKVVLIGDS VGK+ +L+RF +NEFSL+SK+TIGVEF TR++ +  K VKAQIWDTAGQERYRA+TSAYYRGAVGA+LVYD+T+  TF+++ RWL+ELR H D NIVIML GNK DL   RAV TEDA+ FA+KE  FF+ETSA+E+  +E+A   VLT+I+ +VN++ L     +   +P +L   +I++
Sbjct:    8 ASQKIDYVFKVVLIGDSAVGKTQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLTGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEATKLEDAFLTVLTEIFNIVNKKNLAADENQSNSNPASLTGKKILV 206          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: YPT32_YEAST (GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae GN=YPT32 PE=1 SV=3)

HSP 1 Score: 235.728 bits (600), Expect = 4.439e-61
Identity = 111/177 (62.71%), Postives = 147/177 (83.05%), Query Frame = 3
Query:  243 DYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREALEV 773
            DYDYLFK+VLIGDSGVGKSNLLSRFT +EF++ESKSTIGVEFATR+I V++K +KAQIWDTAGQERYRAITSAYYRGAVGAL+VYD+++  ++EN   WL ELR++ D N+ + L+GNK+DL HLRAV T++A++FA +    F ETSAL S NV+ A  E++  I+++V++  +++
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDL 185          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAB25_BOVIN (Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.093e-59
Identity = 112/177 (63.28%), Postives = 145/177 (81.92%), Query Frame = 3
Query:  231 RADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNRE 761
            RA++DY+++FKVVLIG+SGVGK+NLLSRFT+NEFS +S++TIGVEF+TR++ +    +KAQIWDTAG ERYRAITSAYYRGAVGALLV+D+T+H T+  VERWLKEL DH ++ IV+MLVGNK+DL   R V TE+A+ FAE     F+ETSAL+S NVE A   VL +I+  V+++
Sbjct:    4 RAEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAIKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQSREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQ 180          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAB25_MOUSE (Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 1.865e-59
Identity = 113/177 (63.84%), Postives = 143/177 (80.79%), Query Frame = 3
Query:  231 RADDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNRE 761
            R D+DY+++FKVVLIG+SGVGK+NLLSRFT+NEFS +S++TIGVEF+TR++ +    VKAQIWDTAG ERYRAITSAYYRGAVGALLV+D+T+H T+  VERWLKEL DH ++ IV+MLVGNK+DL   R V TE+A  FAE     F+ETSAL+S NVE A   VL +I+  V+++
Sbjct:    4 RTDEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQ 180          
BLAST of DY258624 vs. ExPASy Swiss-Prot
Match: RAB25_HUMAN (Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 5.426e-59
Identity = 115/191 (60.21%), Postives = 149/191 (78.01%), Query Frame = 3
Query:  237 DDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVSTEDAQSFAEKENTFFMETSALESLNVENALPEVLTQIYRVVNREAL-EVRDDPPTLPKGQ 806
            ++DY+++FKVVLIG+SGVGK+NLLSRFT+NEFS +S++TIGVEF+TR++ +    VKAQIWDTAG ERYRAITSAYYRGAVGALLV+D+T+H T+  VERWLKEL DH ++ IV+MLVGNK+DL   R V TE+A+ FAE     F+ETSAL+S NVE A   VL +I+  V+++    +R +  TL   Q
Sbjct:    6 EEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQ 196          
The following BLAST results are available for this feature:
BLAST of DY258624 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RB11A_DICDI5.413e-6769.14Ras-related protein Rab-11A OS=Dictyostelium disco... [more]
RGP1_ORYSJ1.206e-6668.54Ras-related protein RGP1 OS=Oryza sativa subsp. ja... [more]
RB11A_LOTJA2.970e-6567.42Ras-related protein Rab11A OS=Lotus japonicus GN=R... [more]
RB11D_TOBAC1.248e-6363.93Ras-related protein Rab11D OS=Nicotiana tabacum GN... [more]
YPT31_YEAST2.354e-6262.57GTP-binding protein YPT31/YPT8 OS=Saccharomyces ce... [more]
RB11C_TOBAC1.168e-6158.79Ras-related protein Rab11C OS=Nicotiana tabacum GN... [more]
YPT32_YEAST4.439e-6162.71GTP-binding protein YPT32/YPT11 OS=Saccharomyces c... [more]
RAB25_BOVIN1.093e-5963.28Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 ... [more]
RAB25_MOUSE1.865e-5963.84Ras-related protein Rab-25 OS=Mus musculus GN=Rab2... [more]
RAB25_HUMAN5.426e-5960.21Ras-related protein Rab-25 OS=Homo sapiens GN=RAB2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2CG06FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258624 ID=DY258624; Name=DY258624; organism=Citrus clementina; type=EST; length=1280bp
CCCTTCTTAATTTGCAATGTTAATAACATTACTCAAACAAGAAGAAGAAG
AATAGCGAAAGCCTTAGATTTTCTTCATCTGTTCCCATCATCAACTTCAC
CTCACCTGTCTTGCACACACACTCACACTTATCTCTCTCTCTCTATTGCG
TTAATTGCATAATACACAATTCAATAAGAGAGGAGGGGAAAAAAAAAAGA
AGAAAGAAATTGAAAAAAATGGGAGCATACAGAGCTGACGACGACTACGA
TTACTTGTTCAAGGTGGTGTTAATTGGAGATTCAGGAGTTGGGAAATCAA
ATCTGTTATCTCGATTCACCAAGAACGAATTCAGCCTCGAATCGAAATCC
ACCATCGGCGTCGAATTCGCCACTCGCAGCATTCGCGTCGACGACAAGGT
CGTCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAACGATATCGTGCTA
TCACAAGTGCGTACTACCGGGGAGCTGTTGGTGCCTTGCTTGTCTATGAT
GTCACCCGACATGTTACTTTTGAGAATGTTGAGAGATGGTTGAAAGAGCT
TCGGGATCACACAGACTCAAACATTGTGATAATGCTTGTGGGTAACAAGG
CTGATTTGCGTCACTTGCGTGCTGTTTCAACTGAGGATGCTCAGTCGTTC
GCTGAGAAAGAGAACACTTTCTTCATGGAAACCTCTGCCCTAGAGTCGTT
GAATGTTGAAAATGCCCTCCCCGAAGTGCTCACTCAGATATATCGAGTTG
TTAACAGGGAGGCTCTTGAGGTAAGGGATGACCCACCCACCCTGCCCAAG
GGTCAAATTATTATATTGGTACAAAAGATAATGTATCGGCTGTGAAAAAA
ACTGGGTGCTGCTCCTGCATATCCTGCCACCTTCCAAGGAAAATCCCGGG
GGCTAAAAAAAAGTTTCCCCTCTTTTTAAAAATTTAACTTTCCCTTGGTT
TGGAAAAACTCTTGGGTTTTAACTTGGCTGCCCGGAAAAAAAAAAACATG
GGAGGTGCAGGAAAAAAATTTAAGTTTTTACATTTTTCACTCGGGACCCG
GGAAATCTCCCAAATCCTGGGTTGGAAATATAGGGTAAAAAGCCAAAAAT
CTTTTTGGGAATTGGAAAACCCTCCGGGTTTGGTGGGAAGAACCCCACAC
GGTTTTTTTTTTCTTTTTTTGGTGTATTGTCCCTCTTTTGTTTTGTCCCC
CCCCAAAAAAAAAAAATTGGTGAAAAAAAAGTTGTTTTACCCACCCCCCC
CCCCAAAAAACACCCTCCCCAAAAAGAGAA
back to top