DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI3_TOBAC (Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.958e-54
Identity = 108/224 (48.21%), Postives = 133/224 (59.38%), Query Frame = 1
Query:  124 GTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCP-LPGQ-YYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G   G++  IIS  MF+ +L +RND  C  + FYTY+AFI AA++F  FG +G+ T RKRE+AAFFAQT  ETTGGW  AP G YAWGYCY+R+   P S YC +    P  PGQ YYGRGPIQ+++N NY  CG A+G                SFKSAIWFWMTAQ         ++               PGYG+ TNII+GG+ECG G +  V   IGF
Sbjct:   79 GPSTGDISNIISSSMFDQMLKHRNDNTCQGKSFYTYNAFITAARSFRGFGTTGDTTRRKREVAAFFAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPS-YCVQSSQWPCAPGQKYYGRGPIQISYNYNYGPCGRAIGQNLLNNPDLVATNAVVSFKSAIWFWMTAQSPKPSCHDVITGRWTPSAADRAANRLPGYGVITNIINGGLECGHGSDARVQDRIGF 301          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_ORYSJ (Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht2 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.958e-54
Identity = 113/248 (45.56%), Postives = 143/248 (57.66%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHG----------TDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCY--RYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  + +G G          +DG  +G I+ R++FE LL +RND  CPARGFYTY+AF+ AA AFPAFG +GN   RKRE+AAF  QT  ETTGGWP AP G ++WGYC+ +Q   P SDYC      PC    +YYGRGPIQL++N NY   G A+G                SFK+A+WFWMT Q     +   ++               PGYG+ TNI++GG+ECG G +D V   IGF
Sbjct:   63 CGDG--CQSQCSGCGPTPTPTPPSPSDG--VGSIVPRDLFERLLLHRNDGACPARGFYTYEAFLAAAAAFPAFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCF-KQEQNPPSDYCQPSPEWPCAPGRKYYGRGPIQLSFNFNYGPAGRAIGVDLLSNPDLVATDATVSFKTALWFWMTPQGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVANRIGF 305          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 3.863e-54
Identity = 111/223 (49.78%), Postives = 138/223 (61.88%), Query Frame = 1
Query:  133 GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG--FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FP FG SG+ T RKREIAAFFAQT  ETTGGW  AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSA+WFWMT  PQS + +      G  Q      A    PG+G+ TNII+GG+ECG+G +  V   IGF
Sbjct:   77 GGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSP-GDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMT--PQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGF 296          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.468e-53
Identity = 114/232 (49.14%), Postives = 138/232 (59.48%), Query Frame = 1
Query:  115 TGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTG--GWPDAPGGEYAWGYCYIRQVSRPASDYCYR--YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +G     G L  +ISRE F  +L +RND  CPARGFYTYDAFI AA++FPAF  +G++  RKREIAAF AQT  ETTG  GW  AP G YAWGYCY R+++ P S YC      PC    QY+GRGP+QL+WN NY +CG A+G                SFKSA WFWMT Q   P  H       +  +  +        PGYG+ TNII+GG+ECG+G N  V   IGF
Sbjct:   65 SGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELN-PPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDR---AAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGF 291          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_ORYSJ (Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht1 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.917e-53
Identity = 109/248 (43.95%), Postives = 138/248 (55.65%), Query Frame = 1
Query:   67 GSAQNCGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVS-RPASDYCYR--YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRA-TKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G    C      G      G  G  +  I+SR +F+ +L +RND  CPA+ FYTYDAF+ AA AFP+F  +G+   RKRE+AAF AQT  ETTGGW  AP G Y+WGYC+  + +    SDYC +    PC    +YYGRGPIQ+++N NY   G+A+G                SFK+A WFWMT Q   P  H   T   + NGN Q         PGYG+ TNII+GG+ECG G +  V   IGF
Sbjct:   54 GCQSQCSGSCGGGGPTPPSGGGGSGVASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPSFATTGDAATRKREVAAFLAQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSSQWPCAAGKKYYGRGPIQISYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTPQSPKPSCHAVMTGQWTPNGNDQ----AAGRVPGYGVVTNIINGGVECGHGADSRVADRIGF 297          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_SOLTU (Endochitinase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.504e-53
Identity = 109/241 (45.23%), Postives = 139/241 (57.68%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTD---GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CGSG  C  +  G G     GG+LG  IS  MF+ +L +RN+  C  + FY+Y+AFI AA++FP FG SG+   RKREIAAFFAQT  ETTGGW  AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFK+A+WFWMT Q         +    N           PG+G+ TNII+GG+ECG+G ++ V   IGF
Sbjct:   57 CGSGN-CQSQCPGGGPGPGPGGDLGSAISNSMFDQMLKHRNENSCQGKNFYSYNAFINAARSFPGFGTSGDINARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLRERGNP-GDYCPPSSQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVIIGRWNPSSADRAANRLPGFGVITNIINGGLECGRGTDNRVQDRIGF 295          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.504e-53
Identity = 113/241 (46.89%), Postives = 142/241 (58.92%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARG-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG--FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            C SG        G G  GG++G +IS  MF+ +L +RND  C  +  FY+Y+AFI AA++F  FG +G+ T RKREIAAFFAQT  ETTGGWP AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSAIWFWMT  PQS + +      G  Q      A    PG+G+ TNII+GG+ECG+G +  V   IGF
Sbjct:   58 CPSGPSPKPPTPGPGPSGGDIGSVISNSMFDQMLKHRNDNACQGKNNFYSYNAFINAARSFGGFGTTGDTTARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSP-GDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSAIWFWMT--PQSPKPSCHDVIIGRWQPSAADRAANRLPGFGVITNIINGGLECGRGSDSRVQDRIGF 295          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.504e-53
Identity = 116/246 (47.15%), Postives = 144/246 (58.54%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARG-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG-------FPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            CG G  C  +  G     G+LG +IS  MF+ +L +RND  C  +G FY+Y+AFI AA +FP FG +G+ T RKREIAAFFAQT  ETTGGWP AP G YAWGYC++R+   P  DYC      PC    +Y+GRGPIQ++ N NY  CG A+G                SFKSAIWFWMT  PQS + +      G  Q     P+G        PG+G+ TNII+GG+ECG G +  V   IGF
Sbjct:   49 CGPGN-CQSQCPGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKGNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSP-GDYCTPSSQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDSVISFKSAIWFWMT--PQSPKPSCHDVITGRWQ-----PSGVDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGF 285          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.515e-53
Identity = 107/237 (45.15%), Postives = 135/237 (56.96%), Query Frame = 1
Query:   85 GSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            G G   G    G G  GG +  ++S+E+FE LL +RND  CPARGFYTYDA + AA AFP F  +G++  RKRE+AAF  QT  ETTGGW  AP G Y+WGYC+  ++   AS YC      PC    +Y+GRGPIQL++N NY   GEA+G                SFK+A+WFWMT Q         ++               PGYG+ TNII+GG+ECG G +D V   IGF
Sbjct:   67 GGGGGGGGGGGGGGGGGGAVEAVVSKELFEQLLLHRNDAACPARGFYTYDALVTAAAAFPDFAATGDDEARKREVAAFLGQTSHETTGGWATAPDGPYSWGYCFKEEIGATAS-YCVPSAEWPCAPDKKYFGRGPIQLSYNYNYGPAGEAIGEDLLNNPELVASDPVVSFKTALWFWMTPQSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGF 302          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 1.623e-52
Identity = 113/232 (48.71%), Postives = 137/232 (59.05%), Query Frame = 1
Query:  115 TGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTG--GWPDAPGGEYAWGYCYIRQVSRPASDYCYR--YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQ---PQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +G     G L  +ISRE F  +L +RND  CPARGFYTYDAFI AA++FPAF  +G++  RKREIAAF AQT  ETTG  GW  AP G YAWGYCY R+++ P S YC      PC    QY+GRGP+QL+WN NY +CG A+G                SFKSA WFWMT Q   P  H       +  +  +         GYG+ TNII+GG+ECG+G N  V   IGF
Sbjct:   43 SGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELN-PPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDR---AAGRATGYGVITNIINGGLECGKGWNAQVEDRIGF 269          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI3_TOBAC2.958e-5448.21Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3... [more]
CHI2_ORYSJ2.958e-5445.56Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI1_TOBAC3.863e-5449.78Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI1_GOSHI1.468e-5349.14Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI1_ORYSJ1.917e-5343.95Chitinase 1 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_SOLTU2.504e-5345.23Endochitinase OS=Solanum tuberosum PE=2 SV=1[more]
CHI4_SOLTU2.504e-5346.89Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHI1_SOLTU2.504e-5347.15Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHI9_ORYSJ9.515e-5345.15Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI2_GOSHI1.623e-5248.71Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top