DY259745

Overview
NameDY259745
Unique NameDY259745
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1023
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 4.898e-41
Identity = 96/236 (40.68%), Postives = 116/236 (49.15%), Query Frame = 1
Query:   85 GSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGG-NDPVPTPIGF 789
            G G   G    G G   G L  II   MF+D+L YRND +CPA GFYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT  ET G WP A G +Y WGYC++                                 N NY  CG+ L                 +FK+A+WFWMT Q         ++ +             PGYG+ TNII+GGIECGQGG N+     IGF
Sbjct:   66 GGGGGGGGGGGGGGGGDGYLSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETNGWWPAAQGDQYDWGYCHM---------------------------------NYNYGLCGDDLNLPLLQEPELVETDPFIAFKTALWFWMTPQSPKPSCHAVITESWTPSAADSEAGRVPGYGVITNIINGGIECGQGGPNNANENRIGF 268          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSJ (Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 4.898e-41
Identity = 95/224 (42.41%), Postives = 126/224 (56.25%), Query Frame = 1
Query:  133 GGELG--KIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG-----FPGYGLTTNIIHGGIEC--GQGGNDPV 771
            GG  G   +++ + FE +LP+R+D  CPARGFY Y AF+ AA AFPAF  +G+   RKRE+AAF AQT   T+       GG Y+WGYCY ++V    SD+C      PC     Y+ RGP+Q+ +N NY   GEA+G                +FK+A+W WMTA+  S  +  ++ T     Q   TPA       PGYGLTTNI+ GG++C  G GG D V
Sbjct:   92 GGRAGVASVVTSDQFERMLPHRDDAACPARGFYAYRAFVAAAGAFPAFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCY-KEVKGATSDFCVPNARWPCAPGKAYHARGPMQIAYNYNYGAAGEAIGADLLGNPELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTG----QWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGADRV 303          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSI (Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 4.898e-41
Identity = 95/224 (42.41%), Postives = 126/224 (56.25%), Query Frame = 1
Query:  133 GGELG--KIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYC--PCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAG-----FPGYGLTTNIIHGGIEC--GQGGNDPV 771
            GG  G   +++ + FE +LP+R+D  CPARGFY Y AF+ AA AFPAF  +G+   RKRE+AAF AQT   T+       GG Y+WGYCY ++V    SD+C      PC     Y+ RGP+Q+ +N NY   GEA+G                +FK+A+W WMTA+  S  +  ++ T     Q   TPA       PGYGLTTNI+ GG++C  G GG D V
Sbjct:   92 GGRAGVASVVTSDQFERMLPHRDDAACPARGFYAYRAFVAAAGAFPAFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCY-KEVKGATSDFCVPNARWPCAPGKAYHARGPMQIAYNYNYGAAGEAIGADLLGNPELVATDPTVAFKTALWLWMTARSPSQPSPHAVVTG----QWTPTPADSAAGRAPGYGLTTNILTGGLQCAGGNGGADRV 303          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI8_POPTR (Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.926e-37
Identity = 82/207 (39.61%), Postives = 110/207 (53.14%), Query Frame = 1
Query:  157 SREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC--YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWM----TAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGG 759
            +  MFE +LP RN+  CP +GFYTYDA+  A + +P FG +G++  RKRE+AAFFAQT  ET+G         + WGYC + +++ P SDYC        P    YYGRGP+QL WN NY  CG  LG                SF++A+WFWM    T  P  H     ++   +  +        PG+G+ TNII  G EC + G
Sbjct:   68 TESMFEQMLPNRNNDSCPGKGFYTYDAYFVATEFYPGFGMTGDDDTRKRELAAFFAQTSQETSGRSIIGEDAPFTWGYCLVNELN-PNSDYCDPKTKSSYPCVADYYGRGPLQLRWNYNYGECGNYLGQNLLDEPEKVATDPVLSFEAALWFWMNPHSTGAPSCHEV---ITGEWSPSEADIEAGRKPGFGMLTNIITNGGECTKDG 270          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIT_AVESA (Endochitinase (Fragments) OS=Avena sativa PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 9.559e-37
Identity = 86/216 (39.81%), Postives = 112/216 (51.85%), Query Frame = 1
Query:  142 LGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            +  +IS  +FE +L +R        GFYTYDAFI AAK+FPAF  +G+  +RKRE+AAF AQT  ETTGGWP AP G Y  G           SD             Y+GRGPIQ+++N NY   G+A+G                 FK+A+WFWMT Q     +   ++   +           PGYG+ TNII GG+ECG+G    V   IG+
Sbjct:    1 VSSVISSSLFEKMLLHR--------GFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELG---------STSD-------------YFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGY 186          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: AGI_URTDI (Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 8.968e-27
Identity = 70/209 (33.49%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  115 TGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYCYRY-CPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTA---QPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNII 729
            +G+ T       +++  +F+ +  +R D  CP++GFY+Y +F+ AA++FPAFG  G+   RKRE+AAF A     T+G   D     +AWG C+I   +   +D+C     PC    +Y  RGPIQLT N NY   G+A+G                SFK+A+WFWM+    +P  H    + ++  N           P  G+  NII
Sbjct:  121 SGNSTANSIGNVVVTEPLFDQMFSHRKD--CPSQGFYSYHSFLVAAESFPAFGTIGDVATRKREVAAFLAHISQATSGERSDVE-NPHAWGLCHINTTTVTENDFCTSSDWPCAAGKKYSPRGPIQLTHNFNYGLAGQAIGEDLIQNPDLVEKDPIISFKTALWFWMSQHDNKPSCHDIVLNANSAANR---------IPNKGVIGNII 317          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.171e-26
Identity = 76/248 (30.65%), Postives = 110/248 (44.35%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVG 816
            CG+G   G  D    T+   +  I++ E F  L+   +D  C A+GFYT DAF+ AA  +P+FG +G+    KREIAAFFA    ET               +CYI ++  P+ +YC       PC     YYGRGP+Q++WN NY   G+++G                +F++A+W+W               TN  H           G+G T   I+G +EC       V   + +   F  Q G
Sbjct:   49 CGTGCQAGPCDVP-ATNDVSVASIVTPEFFAALVAQADD-GCAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKREIAAFFAHANHETI-------------KFCYIEEIDGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPVLAFQTALWYW---------------TNNVHDAF----VSGQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFCQQFG 262          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.106e-24
Identity = 75/255 (29.41%), Postives = 112/255 (43.92%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTDGG-----ELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDP--VPTPIGFLTPFRWQVG 816
            CG G   G   +G G  G       +  +++   F  +        C  + FYT  AF+ A K +P F + G++   KREIAAFFA    ET               +CYI ++++ ++ YC    R  PC    +YYGRGP+Q++WN NY   G A+G                +FK+A+WFWM             S +G   Q         G+G TT  +   +EC  GGN+P  +   +G+   +  Q+G
Sbjct:   44 CGDGCQSGPCRSGRGGGGSGGGGANVASVVTSSFFNGIKNQAGS-GCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHET-------------GHFCYISEINK-SNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMN------------SVHGVVPQ---------GFGATTRAMQRALEC--GGNNPAQMNARVGYYRQYCRQLG 260          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.583e-23
Identity = 80/253 (31.62%), Postives = 104/253 (41.11%), Query Frame = 1
Query:   79 NCGSGVVCGERDT-----------GHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASD-YCYR----YCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGF 789
            NC SG   G   T           G G  G  +  I+S+  F+ ++  +    CP + FYT  AF+ A    P FGN G+    KREIAAFFA    ETT               C+I +      D YC +      PC    +YYGRGP+QL+WN NY   G+A+G                SFK+A+WFWMT                 H  +        G+G TT  I+G +EC     D     I F
Sbjct:   55 NCQSGPCEGGTPTTPTTPTTPTTPGTGGGGSSVSDIVSQAFFDGIIG-QAAASCPGKNFYTRAAFLSAVD--PKFGNEGSSDDNKREIAAFFAHISHETTN-------------LCHIEERDGDVGDAYCDQDKAAQYPCAAGKKYYGRGPLQLSWNYNYALAGQAIGFDGLGNPEKVATDVNTSFKAAMWFWMT---------------NVHSVMN------QGFGATTKAINGALECNGQNQDQANDRIQF 270          
BLAST of DY259745 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 7.856e-23
Identity = 75/252 (29.76%), Postives = 108/252 (42.86%), Query Frame = 1
Query:   82 CGSGVVCGERDTGHGTD----GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGDETTGGWPDAPGGEYAWGYCYIRQVSRPASDYC---YRYCPCPLPGQYYGRGPIQLTWNCNYLRCGEALGXXXXXXXXXXXXXXXXSFKSAIWFWMTAQPQSHRATKSLSTNGNHQQLK*TPAGFPGYGLTTNIIHGGIECGQGGNDPVPTPIGFLTPFRWQVG 816
            CG+G   G   +  GT     GG +G I+++  F  ++       C  + FYT D+FI AA  FP F NS    + +REIA  FA    ET               +CYI +++  + DYC    R  PC     Y+GRGPIQL+WN NY  CG++L                 +F++ +WFWM +                       P    G+G T   I+ G+EC  G +  V   I +   +  Q+G
Sbjct:   48 CGTGCRSGPCRSPGGTPSPPGGGSVGSIVTQAFFNGIINQAGG-GCAGKNFYTRDSFINAANTFPNFANS----VTRREIATMFAHFTHETGH-------------FCYIEEINGASRDYCDENNRQYPCAPGKGYFGRGPIQLSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSV---------------------RPVLNQGFGATIRAIN-GMECNGGNSGAVNARIRYYRDYCGQLG 259          
The following BLAST results are available for this feature:
BLAST of DY259745 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHIB_POPTR4.898e-4140.68Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
CHI7_ORYSJ4.898e-4142.41Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI7_ORYSI4.898e-4142.41Chitinase 7 OS=Oryza sativa subsp. indica GN=Cht7 ... [more]
CHI8_POPTR1.926e-3739.61Endochitinase WIN8 OS=Populus trichocarpa GN=WIN8 ... [more]
CHIT_AVESA9.559e-3739.81Endochitinase (Fragments) OS=Avena sativa PE=1 SV=... [more]
AGI_URTDI8.968e-2733.49Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE... [more]
CHI6_ORYSJ1.171e-2630.65Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIB_MAIZE7.106e-2429.41Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHIP_BETVU1.583e-2331.62Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHI4_BRANA7.856e-2329.76Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
Fruit-TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP10YB02FM1 Fruit-TF Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY259745 ID=DY259745|Name=DY259745|organism=Citrus clementina|type=EST|length=1023bp
GCTTTCAAAATGAGGCTCATTGGGTCCTTACTAATTTTCTCTCTAGTTTT
ATCTTTTGTACTAGGAGGTTCAGCACAGAATTGTGGAAGCGGCGTTGTGT
GCGGTGAACGTGATACTGGCCACGGGACGGATGGCGGTGAACTGGGCAAG
ATCATCTCAAGGGAGATGTTTGAAGACTTGCTTCCGTATAGAAATGATGT
ACGATGCCCTGCCAGAGGCTTCTACACTTACGATGCTTTTATAGAGGCAG
CCAAAGCTTTTCCAGCCTTTGGTAACTCTGGAAATGAAACCATGCGTAAA
AGAGAAATTGCTGCCTTTTTTGCCCAAACTGGCGATGAAACTACTGGGGG
ATGGCCCGATGCACCTGGTGGAGAATATGCTTGGGGATATTGCTATATTA
GGCAAGTTAGCCGCCCTGCGTCCGACTACTGTTATCGTTACTGTCCATGT
CCTTTGCCAGGGCAATACTATGGCCGAGGTCCAATTCAACTCACTTGGAA
TTGCAATTACTTAAGGTGCGGAGAAGCCTTGGGGGTGGACTTGTTGAACA
ATCCAGACCTTCTTGCCCCTGATCCAGTACTATCATTCAAGTCAGCAATC
TGGTTCTGGATGACTGCACAGCCCCAAAGCCATCGTGCCACGAAGTCATT
ATCGACGAATGGAAACCATCAGCAATTGAAGTAAACGCCCGCCGGCTTCC
CGGGATACGGTCTAACCACAAATATAATCCACGGTGGAATTGAATGTGGC
CAAGGTGGGAATGACCCTGTACCCACCCCTATTGGGTTCCTTACCCCTTT
TCGGTGGCAAGTTGGGGATTCGGCCCGGTGACCACCCTGATTGCCACACC
CACGGCCCTAAGGGCCTAACCGAAGGGCCCATTCCTAGTGATCCCCCTGA
TCCAGGTTTTAATAAATAAACCCTAATAAAAACCCACCTAAAAAAAACTT
TTAAATGGCCCAGTTGGTAGGGGGGCAACTAAATTTTTTCCTTTGGTTCC
CCCCTTATTGCAAGTAAAATAAA
back to top