EH406243

Overview
NameEH406243
Unique NameEH406243
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length690
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH406243 vs. ExPASy Swiss-Prot
Match: NO93_SOYBN (Early nodulin-93 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.391e-18
Identity = 49/92 (53.26%), Postives = 60/92 (65.22%), Query Frame = 1
Query:  172 NSPLIASPAEDLKAKAA--NDCVQEGVRAGLKAAAVMCVVTAVPTLVAVRKIPWAKANLNYTGQALIISAVSIASYFITVDKTILECARRNA 441
            NSPL       L  K A    C  EGV AG KAA V  V +A+PTL +VR +PWA+ANLN+T QALIIS  + A+YFI  DKT+L  AR+N+
Sbjct:    5 NSPLERPSLASLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMLPWARANLNHTAQALIISTATAAAYFIVADKTVLATARKNS 96          
The following BLAST results are available for this feature:
BLAST of EH406243 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
NO93_SOYBN2.391e-1853.26Early nodulin-93 OS=Glycine max PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2AG09ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH406243 ID=EH406243; Name=EH406243; organism=Citrus clementina; type=EST; length=690bp
GAGAGATCAAAATCGAAACGAACACTGCAATGCACTGTCCTCCTCAAATC
TTAATCCGCCATCCATTTTTGAGTTTCTTATTCTAATTAAGAAGAAGAAG
AAGAAGAAGAAGAAGAAGGAATGGGATTTCCGTCGGAAGTTAGAGATATT
TTTGTATCCAGAAGGTCAAATAACTCGCCACTGATTGCCTCTCCTGCTGA
AGATCTAAAGGCTAAGGCCGCCAACGACTGCGTTCAAGAAGGCGTTCGAG
CTGGATTAAAGGCCGCTGCCGTAATGTGTGTTGTCACCGCTGTGCCGACG
TTGGTTGCAGTTCGAAAAATTCCTTGGGCAAAGGCAAACCTGAATTATAC
TGGTCAGGCACTCATCATATCCGCAGTGTCAATTGCTTCTTACTTCATCA
CTGTTGACAAGACTATTTTGGAGTGTGCAAGGAGGAATGCCCAGTATGGC
AAACCAACTTGAGATTCTGTACCTGAAGCAATTCACCATGAAGATGCCAT
GATATGCGTAGTGAGCATAGCACGCAGGTTCATATGAGAATATTTAAATG
TATTTGAGACAATTTTTTTCCCCACTTGAGCAACCGATGGAATTCTCGTG
CAATAAGTTTACCATTTTATCTTTGGCTGATATCTCTATACTAACTTATC
CTTATTGATATGATTATGAGAAATTAACGAGCACTCTGCT
back to top