EH406247

Overview
NameEH406247
Unique NameEH406247
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length652
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR36_ARATH (Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=GLR3.6 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.621e-24
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 2
Query:   68 ELSENGDLQRIHDKWLTRSACSSQGAKQEADRLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLDLQERESAGPSSQSSRLQTFISFAGEKEVVIK-NLSKKRKLERAS 406
            +LSENGD+QRI DKWL R ACS QGA+ E DRL LKSFW               +Y + ++RQF +   +  E      SS S+R+ +F+SF  EKE   K   S++R+LE  S
Sbjct:  782 QLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQFGQQCPEEAEGSIRRRSSPSARIHSFLSFVKEKEEDAKARSSRERQLEDIS 895          

HSP 2 Score: 41.9726 bits (97), Expect = 7.621e-24
Identity = 18/21 (85.71%), Postives = 20/21 (95.24%), Query Frame = 3
Query:    6 GWGFAFPRDSPLAVDMSIAIL 68
            GWGFAFPR+SPLAVD+S AIL
Sbjct:  761 GWGFAFPRNSPLAVDVSAAIL 781          
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR32_ARATH (Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.653e-20
Identity = 44/113 (38.94%), Postives = 64/113 (56.64%), Query Frame = 2
Query:   71 LSENGDLQRIHDKWLTRSACSSQG---AKQEADRLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLDLQERESAGPSSQSSR---LQTFISFAGEKEVVIKNLSKKRK 391
            LSE G LQ+IHDKWL+RS CS+     + +++++L L+SFW               IY  +IVR F RH     + E+  PS +SSR   LQTF+++  EKE   K   K+++
Sbjct:  790 LSETGQLQKIHDKWLSRSNCSNLNGSVSDEDSEQLKLRSFWGLFLVCGISCFIALFIYFFKIVRDFFRH--GKYDEEATVPSPESSRSKSLQTFLAYFDEKEDESKRRMKRKR 900          

HSP 2 Score: 45.0542 bits (105), Expect = 2.653e-20
Identity = 19/21 (90.48%), Postives = 20/21 (95.24%), Query Frame = 3
Query:    6 GWGFAFPRDSPLAVDMSIAIL 68
            GWGFAFPRDSPLA+DMS AIL
Sbjct:  768 GWGFAFPRDSPLAIDMSTAIL 788          
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR33_ARATH (Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=GLR3.3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.324e-19
Identity = 56/140 (40.00%), Postives = 77/140 (55.00%), Query Frame = 2
Query:   68 ELSENGDLQRIHDKWLTRSACSSQGAKQEADRLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLD-----LQERESAGPSSQSSRLQTFISFAGEKEVVIKNLSKKRKLERASTGDIDKDKSTDGDLNGSVNPGN 472
            EL+ENGDLQRIHDKWL ++AC+ + A+ E+DRLHLKSFW               +Y +QI+RQ  +   D      Q++     S +S+RLQ F+S   EKE   K+ SKKRK++ +        +S   D   S N  N
Sbjct:  792 ELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKSFWGLFLICGVACLLALFLYFVQIIRQLYKKPTDDAIARDQQQNHDSSSMRSTRLQRFLSLMDEKE-ESKHESKKRKIDGSMNDTSGSTRSRGFDRERSFNSVN 930          
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR34_ARATH (Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 2.339e-13
Identity = 38/124 (30.65%), Postives = 56/124 (45.16%), Query Frame = 2
Query:   68 ELSENGDLQRIHDKWLT-RSACSSQGAKQEADRLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLDLQERESAGPSSQSSRLQTFISFAGEKEVVIKNLSKKRKLERASTGDIDKDKST 436
            +LSE G+L++IH KWL  +  CS Q +  E  +L LKSFW               ++  ++  Q+ R   +  + E AG  S+ SR     S  G +    K L K      A   +I K KS+
Sbjct:  820 QLSEEGELEKIHRKWLNYKHECSMQISNSEDSQLSLKSFWGLFLICGITCFMALTVFFWRVFWQYQRLLPESADEERAGEVSEPSR-----SGRGSRAPSFKELIKVVDKREAEIKEILKQKSS 938          

HSP 2 Score: 42.3578 bits (98), Expect = 2.339e-13
Identity = 19/21 (90.48%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    6 GWGFAFPRDSPLAVDMSIAIL 68
            GWGFAF RDSPLAVDMS AIL
Sbjct:  799 GWGFAFQRDSPLAVDMSTAIL 819          
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR37_ARATH (Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=GLR3.7 PE=2 SV=2)

HSP 1 Score: 50.0618 bits (118), Expect = 4.143e-12
Identity = 34/116 (29.31%), Postives = 55/116 (47.41%), Query Frame = 2
Query:   68 ELSENGDLQRIHDKWLTRSACSSQGA-KQEADRLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLDLQERESAGPSSQSSRLQT---------FISFAGEKEVVIKNLSKK 385
            +LSE   LQ I  KWL ++ C+ +     E ++LHLKSF                +++++++RQF R+     ER S+ P +  S   T         F+ F  EKE  IK + ++
Sbjct:  785 KLSETRKLQEIRKKWLCKTNCAGKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRY--RRMERTSSMPRASWSASPTLRLRELVFDFVEFVDEKEEAIKRMFRR 898          

HSP 2 Score: 41.9726 bits (97), Expect = 4.143e-12
Identity = 18/21 (85.71%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    6 GWGFAFPRDSPLAVDMSIAIL 68
            GWGFAF RDSPLA+DMS AIL
Sbjct:  764 GWGFAFKRDSPLAIDMSTAIL 784          
BLAST of EH406247 vs. ExPASy Swiss-Prot
Match: GLR31_ARATH (Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.495e-11
Identity = 41/112 (36.61%), Postives = 62/112 (55.36%), Query Frame = 2
Query:   71 LSENGDLQRIHDKWLTRSACSSQGAKQEAD--RLHLKSFWXXXXXXXXXXXXXXXIYLIQIVRQFARHYLDLQERESAGPSSQSSRL---QTFISFAGEKEVVIKNLSKKRK 391
            LSE G+LQ+IHD+WL++S CSS    Q  D  +L++ SFW               I+  +I+R F +   ++   E+  PS +SSRL   QTF++F  EKE   K   K+++
Sbjct:  790 LSETGELQKIHDRWLSKSNCSSPHGSQSGDSEQLNVHSFWGMFLVVGIACLVALFIHFFKIIRDFCKDTPEVVVEEAI-PSPKSSRLTKLQTFLAFVDEKEEETKRRLKRKR 900          
The following BLAST results are available for this feature:
BLAST of EH406247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
GLR36_ARATH7.621e-2443.86Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=... [more]
GLR32_ARATH2.653e-2038.94Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=... [more]
GLR33_ARATH3.324e-1940.00Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=... [more]
GLR34_ARATH2.339e-1330.65Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=... [more]
GLR37_ARATH4.143e-1229.31Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=... [more]
GLR31_ARATH1.495e-1136.61Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2BA11ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH406247 ID=EH406247; Name=EH406247; organism=Citrus clementina; type=EST; length=652bp
GAATTGGGTGGGGATTTGCATTTCCAAGGGACTCACCTCTTGCAGTTGAC
ATGTCAATTGCCATCCTGAACTATCAGAGAATGGAGATCTGCAAAGAATT
CATGACAAGTGGCTCACAAGAAGCGCTTGCAGTTCACAAGGCGCAAAGCA
AGAAGCAGACCGGCTTCATCTTAAAAGCTTTTGGGGCCTCTTTGTTTTGT
GTGGTGTAGCTTGCTTGCTTGCTCTCTTAATATATCTCATACAGATTGTA
CGCCAGTTTGCCAGGCATTATCTGGACTTGCAAGAGCGTGAGTCTGCAGG
TCCAAGCTCACAAAGTTCACGTCTTCAAACATTTATTTCATTTGCCGGCG
AGAAGGAAGTCGTAATAAAAAATCTCTCCAAGAAAAGAAAATTGGAGAGG
GCGTCAACTGGAGACATAGATAAAGATAAATCCACGGACGGGGACTTAAA
TGGGAGTGTTAATCCTGGTAATGAAGCCAAATTAGTTGCATTTGAGGTCT
TTGGTCATAATTCGCATTTTTATTAGATATGTCAATGTTAGGATAGTACT
TGTCTTTATAGTTGCAAATGGAATTGTGTTAGCACTCTGCAAGTGTAATT
GTAGGCAAACAAAATCTACAGCTGCCAATAAATCTCATGGCAATTTAGTC
TC
back to top