EH406249

Overview
NameEH406249
Unique NameEH406249
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length516
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA4_ARATH (Metacaspase-4 OS=Arabidopsis thaliana GN=AMC4 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 8.878e-36
Identity = 69/101 (68.32%), Postives = 86/101 (85.15%), Query Frame = 2
Query:    2 GSKKDVYAGGSKRS--LPDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC 298
            GSK++VYAGGS+ S  LPD GIL+SGCQTDQTSADA+P+GK +EAYGA+SN+IQ I+ E+DG ++NRE+V   R+ LKKQGFTQQPGLYCHD + + PFIC
Sbjct:  318 GSKEEVYAGGSRGSVPLPDSGILISGCQTDQTSADATPAGKPTEAYGAMSNSIQTILEETDGEISNREMVTRARKALKKQGFTQQPGLYCHDGYANAPFIC 418          
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA5_ARATH (Metacaspase-5 OS=Arabidopsis thaliana GN=AMC5 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.778e-32
Identity = 63/99 (63.64%), Postives = 79/99 (79.80%), Query Frame = 2
Query:    2 GSKKDVYAGGSKRSLPDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC 298
            G+K++VYAG S  SL D GIL+SGCQTDQTSADASP G    AYGA +NA+QII+ E+ G +T +ELVL  R++LKKQGF+Q+PGLYC D+ V+ PFIC
Sbjct:  312 GNKQEVYAGASNGSLADNGILISGCQTDQTSADASPQGHPEMAYGAFTNAVQIILEETKGMITYKELVLKARKLLKKQGFSQRPGLYCSDSFVNAPFIC 410          
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA6_ARATH (Metacaspase-6 OS=Arabidopsis thaliana GN=AMC6 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 7.280e-30
Identity = 60/96 (62.50%), Postives = 77/96 (80.21%), Query Frame = 2
Query:   11 KDVYAGGSKRSLPDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC 298
            +DVYAG    +LPD GIL+SGCQTDQTS+DASP G    AYGAL+NAIQIII E+ G ++N++LVL  R++L+KQGF Q+PGLYC+D +V+  FIC
Sbjct:  273 QDVYAGAINGALPDNGILISGCQTDQTSSDASPPGHPELAYGALTNAIQIIIGETKGKISNKDLVLKARKLLRKQGFDQRPGLYCNDAYVNARFIC 368          
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA7_ARATH (Metacaspase-7 OS=Arabidopsis thaliana GN=AMC7 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 7.796e-24
Identity = 55/101 (54.46%), Postives = 74/101 (73.27%), Query Frame = 2
Query:    5 SKKDVYAGGSKRSL-PDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESD--GAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC 298
            S +++Y G S   L PD GIL+SGCQTD+TSAD    G   EA+GA SNAIQ++++E+D    +TN+E+VL  R++LKKQ F Q+PGLYC+D  V+ PFIC
Sbjct:  306 SDREIYGGRSSNGLFPDRGILLSGCQTDETSADVKKKG---EAFGAFSNAIQMVLSETDHKDKITNKEMVLRAREILKKQMFIQRPGLYCNDRFVNAPFIC 403          
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA8_ARATH (Metacaspase-8 OS=Arabidopsis thaliana GN=AMC8 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.165e-19
Identity = 49/96 (51.04%), Postives = 68/96 (70.83%), Query Frame = 2
Query:   23 AGGSK-RSLPDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIA---ESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC 298
            +G S+  ++ D GIL+SGCQTDQ S D   + +  +AYGA S+AIQ+I++   +    +TN+ELV   R  LKK+G++Q+PGLYCHD  VDKPFIC
Sbjct:  286 SGASRLNAVTDNGILLSGCQTDQRSEDVYVT-RTGKAYGAFSDAIQMILSAPRKDKKKITNKELVSEARVFLKKRGYSQRPGLYCHDRFVDKPFIC 380          
BLAST of EH406249 vs. ExPASy Swiss-Prot
Match: MCA9_ARATH (Metacaspase-9 OS=Arabidopsis thaliana GN=AMC9 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.508e-16
Identity = 40/82 (48.78%), Postives = 56/82 (68.29%), Query Frame = 2
Query:   50 DGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFI 295
            D GIL+SGCQ D+TSAD        +AYGA SNAIQ ++ E++GA+ N++LV+  R +L++ GF Q P LYC D + D  F+
Sbjct:  243 DSGILMSGCQADETSADVGVGN--GKAYGAFSNAIQRVLNENEGAMKNKQLVMMARDVLERLGFHQHPCLYCSDQNADATFL 322          
The following BLAST results are available for this feature:
BLAST of EH406249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
MCA4_ARATH8.878e-3668.32Metacaspase-4 OS=Arabidopsis thaliana GN=AMC4 PE=1... [more]
MCA5_ARATH7.778e-3263.64Metacaspase-5 OS=Arabidopsis thaliana GN=AMC5 PE=1... [more]
MCA6_ARATH7.280e-3062.50Metacaspase-6 OS=Arabidopsis thaliana GN=AMC6 PE=1... [more]
MCA7_ARATH7.796e-2454.46Metacaspase-7 OS=Arabidopsis thaliana GN=AMC7 PE=1... [more]
MCA8_ARATH1.165e-1951.04Metacaspase-8 OS=Arabidopsis thaliana GN=AMC8 PE=1... [more]
MCA9_ARATH3.508e-1648.78Metacaspase-9 OS=Arabidopsis thaliana GN=AMC9 PE=1... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2BA12ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH406249 ID=EH406249; Name=EH406249; organism=Citrus clementina; type=EST; length=516bp
GGGCAGCAAGAAGGATGTTTATGCTGGAGGAAGCAAGCGCTCACTTCCTG
ATGGTGGGATTTTGGTCAGTGGATGTCAGACTGACCAAACTTCTGCTGAT
GCCAGCCCTTCTGGGAAGGCTAGCGAAGCTTACGGAGCTCTCAGCAATGC
AATTCAGATAATTATTGCTGAATCAGATGGTGCAGTGACTAACCGGGAGC
TTGTTTTGTCCACTAGGCAGATGTTGAAGAAGCAGGGATTCACTCAGCAA
CCTGGCCTTTATTGCCATGATAATCATGTTGATAAGCCGTTTATCTGCTG
ATACGAGCGGGTGCTTTTGGGGTTCAGGAGATCGAATAATTTAAACAGTT
TGCAGGGTTTGTTGTGCTCTTTATGGATATGGTTTGAGTTTCATGTAGAT
AAAAAACTTGTTTGAGTTTCAAACAACAGCTTGCTTGTTTAAGTCTTCAC
ATCTTTTGCCTCGATCTTTGTCGAATTAATCTTGGTCCTTGAATGAAAGT
TTTTAAACGTGTTTTT
back to top