FC868488

Overview
NameFC868488
Unique NameFC868488
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length660
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14169 contig Ccv1_Contig14169:4..663. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 338.576 bits (867), Expect = 1.735e-92
Identity = 164/197 (83.25%), Postives = 171/197 (86.80%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MATSAIQQSAFAGQTAL+QSNE V K+G   GGR++MRRTVKS P SIWYGPDRPKYLGPFS+Q PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFD L
Sbjct:    1 MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPL 197          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.243e-90
Identity = 163/197 (82.74%), Postives = 168/197 (85.28%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MATSAIQQSAFAGQTAL+  NE VRK+G   GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFD L
Sbjct:    1 MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPL 197          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.618e-90
Identity = 160/197 (81.22%), Postives = 169/197 (85.79%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MATSAI+QSAFAGQTAL+  NE VRK+G  +GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFD L
Sbjct:    1 MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPL 197          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 1.796e-89
Identity = 160/197 (81.22%), Postives = 166/197 (84.26%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MAT AIQQSAF GQ   +  NEF+RKVG    GRITMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFD L
Sbjct:    1 MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPL 197          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 328.176 bits (840), Expect = 2.345e-89
Identity = 158/197 (80.20%), Postives = 169/197 (85.79%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MATS IQQSAFAGQT L+  NE VRKVG  +GGR++MRRT+KS P+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWACQVVLMG VEGYR+                AFD L
Sbjct:    1 MATSTIQQSAFAGQTLLKPQNELVRKVG-GNGGRVSMRRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPL 196          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 3.386e-88
Identity = 158/197 (80.20%), Postives = 170/197 (86.29%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MA SAIQ SAFAGQTAL+Q +E VRKVGV+DG R +MRRTVK+ PQSIWYG DRPK+LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFD L
Sbjct:    1 MAASAIQSSAFAGQTALKQRDELVRKVGVSDG-RFSMRRTVKAVPQSIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPL 196          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 5.776e-88
Identity = 157/197 (79.70%), Postives = 165/197 (83.76%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MATSAIQQSAF G+T LRQ NEF+RK G     R TMRRTVKS P+SIWYGPDRPKYLGPFSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFD L
Sbjct:    1 MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPL 197          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 3.874e-84
Identity = 157/197 (79.70%), Postives = 166/197 (84.26%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFD L
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPL 195          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 3.874e-84
Identity = 157/197 (79.70%), Postives = 166/197 (84.26%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFD L
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPL 195          
BLAST of FC868488 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.127e-83
Identity = 155/199 (77.89%), Postives = 165/199 (82.91%), Query Frame = 3
Query:   60 MAT-SAIQQSAFAGQTALR-QSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDHL 650
            MAT SAIQ S+ AGQT LR Q NE V+KVG A   RITMRRTV+S P+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWACQVVLMG +EGYR+                AFD L
Sbjct:    1 MATASAIQSSSLAGQTLLRPQQNELVKKVGTAQA-RITMRRTVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPL 198          
The following BLAST results are available for this feature:
BLAST of FC868488 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CB21_GOSHI1.735e-9283.25Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB26_PETSP1.243e-9082.74Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_TOBAC3.618e-9081.22Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB24_SOLLC1.796e-8981.22Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB21_SILPR2.345e-8980.20Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB21_LEMGI3.386e-8880.20Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB215_PEA5.776e-8879.70Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB23_ORYSJ3.874e-8479.70Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI3.874e-8479.70Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_PINTH1.127e-8377.89Chlorophyll a-b binding protein type I, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001A01EF AbioticL1 Citrus clementina cDNA clone C31001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868488 ID=FC868488|Name=FC868488|organism=Citrus clementina|type=EST|length=660bp
GATTCAGAGTGCGAAAAGAAGCTTCAGCAACAAAAGGAAAAGCTTTCGCA
TAAGAACATATGGCAACCTCTGCTATCCAACAATCAGCATTTGCTGGCCA
GACCGCCTTGAGGCAATCCAATGAGTTTGTCCGCAAGGTTGGAGTTGCTG
ACGGTGGCCGTATCACCATGAGGAGGACTGTCAAATCCACTCCCCAGAGC
ATCTGGTATGGCCCAGACCGCCCAAAGTACTTGGGACCATTCTCTGAGCA
AACACCATCATACTTGACTGGTGAGTTCCCTGGTGACTATGGCTGGGATA
CCGCTGGTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGCTA
GAGGTGATCCACAGCAGATGGGCAATGCTTGGAGCTCTTGGCTGCGTCTT
CCCTGAAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGGT
TCAAGGCTGGCGCTCAAATCTTCTCTGAAGGTGGCCTTGACTATCTTGGC
AACCCCAACCTCATTCATGCTCAGAGCATTTTGGCTATCTGGGCCTGCCA
GGTTGTGCTCATGGGTTTTGTTGAAGGATACAGAATTGGTGGCGGTCCTC
TTGGTGAAGGACTTGACCCACTTTACCCTGGTGGTGCTTTTGACCACTTG
GTTTGGCTGA
back to top