FC868490

Overview
NameFC868490
Unique NameFC868490
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868490_ssr159 microsatellite FC868490_ssr159:159..176. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC868490 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.602e-44
Identity = 111/201 (55.22%), Postives = 126/201 (62.69%), Query Frame = 3
Query:  108 MALTREFMGAFSIFERXXXXXXXKVLLNQSTFWQNKLLQQKQFLV-PVQQRRVHSRKAGAAGVRRGINNPVAALSEDLVKGAASSAV------PGAAERPVKFKVRAVLTVKKNIKEDFKETLVNQFDALTEKIGRNVVLELVGTEVDPRTKGPKKSREAVLKDWSKKSNVKAERVHYTAEFLVDSNFGTPGAITVANKHQ 689
            MAL  E MG+  IFER             S F   K  Q+ QF + P   R +  R   ++GV       VAA+SEDLVK    S V          E+ VKFKVRAV TV+   KEDFKETLV   DA T+KIGRNVVLEL+ T+VDP+T  PKKS+ AVLKDWSKKSN KAERVHYTAEF VDS FG+PGAITV NKHQ
Sbjct:    1 MALANEIMGSRLIFERSSSLASPF----HSRFSIKKKTQRTQFSINPFDPRPM--RAVNSSGV-------VAAISEDLVKTLRISTVGRKQEKEEEEEKSVKFKVRAVATVRNKNKEDFKETLVKHLDAFTDKIGRNVVLELMSTQVDPKTNEPKKSKAAVLKDWSKKSNSKAERVHYTAEFTVDSAFGSPGAITVTNKHQ 188          
BLAST of FC868490 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.399e-41
Identity = 103/200 (51.50%), Postives = 118/200 (59.00%), Query Frame = 3
Query:  108 MALTREFMGAFSIFERXXXXXXXKVLLNQSTFWQNKLLQQKQFLVPVQQRRVHSRKAGAAGVRRGINNPVAALSEDLVKGAASSAVPG------AAERPVKFKVRAVLTVKKNIKEDFKETLVNQFDALTEKIGRNVVLELVGTEVDPRTKGPKKSREAVLKDWSKKSNVKAERVHYTAEFLVDSNFGTPGAITVANKHQ 689
            MAL +E MG   I ER          L  S     K  Q  QF +    RR    K+G           VAA+SEDLVK    S   G        +  VKFKVRAV+TV+   KED KETLV   DA  +KIGRN+VLEL+ T++DP+TK PKKS  AVLKDWSKKS  KAERVHYTAEF VD+ FG+PGAITV NKHQ
Sbjct:    1 MALAKELMGYPLITERSS--------LVSSASHFKKRTQSTQFSINPFDRRPRKTKSGV----------VAAISEDLVKTLRFSTTTGDRKSEEEEKAAVKFKVRAVVTVRNKNKEDLKETLVKHLDAFADKIGRNIVLELISTQLDPKTKLPKKSNAAVLKDWSKKSKTKAERVHYTAEFTVDAAFGSPGAITVMNKHQ 182          
BLAST of FC868490 vs. ExPASy Swiss-Prot
Match: LOX6_ORYSJ (Probable lipoxygenase 6 OS=Oryza sativa subsp. japonica GN=Os03g0179900 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 6.223e-27
Identity = 65/131 (49.62%), Postives = 86/131 (65.65%), Query Frame = 3
Query:  315 VAALSEDLVKGAASSAVP----GAAER---PVKFKVRAVLTVKKNIKEDFKETLVNQFDALTEKIGRNVVLELVGTEVDPRTKGPKKSREAVLKDWSKKSNVKAERVHYTAEFLVDSNFGTPGAITVANKH 686
            VAA+SE++ + AAS +      GA ER   P K  +RA LTV++  KED KE +    DAL + +GRNVVLEL+ T++ PRTK P +S    +KDW +K   K + V YTAEF VD++FG PGAI VAN+H
Sbjct:   45 VAAISEEVPRLAASPSSGIKGGGAGERRPAPEKVALRAALTVRRKQKEDIKEAVAGHLDALWDMVGRNVVLELISTKIHPRTKKPMQSGRVSIKDWCQKRGAKGDHVVYTAEFTVDADFGEPGAIAVANRH 175          
BLAST of FC868490 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 6.223e-27
Identity = 69/150 (46.00%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  276 AGAAGVRRGINN--------PVAALSEDLVKGAASSAVPGAAERPV----KFKVRAVLTVKKNIKEDFKETLVNQFDALTEKIGRNVVLELVGTEVDPRTKGPKKSREAVLKDWSKKSNVKAERVHYTAEFLVDSNFGTPGAITVANKHQ 689
            AG+ G+ +G +         PV AL E +V   A       A RP         RAV+TV++  KED K+    Q DAL +++GR+V+LELV TE DPR   PKKS+ + L  W  K +VKAERV YTAEF VD+ FG PGA+TV N+HQ
Sbjct:   15 AGSRGMGKGASRRRTARSTAPVGALVERVVVAPAPVEQQRGAGRPEAHPQSVAARAVVTVRRRRKEDAKDRFAEQLDALADRVGRSVLLELVSTETDPRKGTPKKSKPSALVGWFDKKDVKAERVVYTAEFAVDAGFGEPGAVTVLNRHQ 164          
The following BLAST results are available for this feature:
BLAST of FC868490 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LOX4_ARATH5.602e-4455.22Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX3_ARATH3.399e-4151.50Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX6_ORYSJ6.223e-2749.62Probable lipoxygenase 6 OS=Oryza sativa subsp. jap... [more]
LOX5_ORYSJ6.223e-2746.00Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31001A05EF AbioticL1 Citrus clementina cDNA clone C31001A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868490 ID=FC868490|Name=FC868490|organism=Citrus clementina|type=EST|length=691bp
ACTTATTTTGCCAATTCCAGCTTCGCTTAGCACATCTCTTGAAAGCTCCT
GCAGCTTATTCAACTTCTGTTTTCAGAGGGATAATAAAAAAGAAAAAAAG
AAAATCGATGGCACTGACTAGAGAATTCATGGGTGCTTTTTCAATATTTG
AGAGATCGTCATCATCATCATCATCAAAAGTGCTTTTAAACCAAAGTACT
TTTTGGCAAAACAAGCTGCTGCAACAAAAGCAGTTTTTGGTACCCGTGCA
ACAGAGAAGAGTGCATTCGAGGAAAGCAGGAGCAGCAGGTGTGAGGAGGG
GGATTAATAATCCTGTGGCTGCTCTAAGTGAAGATTTGGTAAAAGGAGCT
GCTTCCTCTGCCGTGCCCGGGGCTGCTGAAAGGCCAGTGAAGTTTAAGGT
GAGGGCTGTGCTGACGGTGAAGAAGAACATCAAAGAAGATTTCAAAGAGA
CCCTTGTTAATCAGTTTGATGCTTTAACTGAAAAGATTGGCAGAAATGTC
GTTCTGGAACTTGTCGGCACTGAAGTTGATCCCAGAACAAAGGGACCAAA
GAAAAGCAGAGAAGCAGTTCTGAAGGATTGGTCAAAGAAATCAAATGTTA
AGGCTGAACGGGTCCATTACACGGCTGAATTTTTAGTGGACTCAAATTTT
GGGACGCCTGGTGCAATCACAGTTGCCAATAAGCACCAAAG
back to top