FC868503

Overview
NameFC868503
Unique NameFC868503
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length681
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13179 contig Ccv1_Contig13179:32..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 3.888e-75
Identity = 126/173 (72.83%), Postives = 137/173 (79.19%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQ--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            M KD+E +  +GG  EFSAKDY DPPPAPLID EEL KWS YRAVIAEFIA            IGYK Q+D  +NT    C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKVSLIRA+LY++AQCLGAICG G VK FQ SYY RYGGGANEL+DGY++
Sbjct:    1 MAKDIEASAPEGG--EFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSK 171          

HSP 2 Score: 48.9062 bits (115), Expect = 3.888e-75
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGLGAEIIGTFVLVYTVFSATD
Sbjct:  171 KGTGLGAEIIGTFVLVYTVFSATD 194          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 4.245e-74
Identity = 124/173 (71.68%), Postives = 136/173 (78.61%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQ--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            MGKD +V E   G GEF+AKDY DPPPAPLID  ELG WS YRAVIAEFIA            IGYK QTD + +     CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL RKVSL+RALLY+VAQCLGAICG G VKAFQ +Y++RYGGGAN LA GY+R
Sbjct:    1 MGKD-DVIESGAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSR 172          

HSP 2 Score: 48.9062 bits (115), Expect = 4.245e-74
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGLGAEIIGTFVLVYTVFSATD
Sbjct:  172 RGTGLGAEIIGTFVLVYTVFSATD 195          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 7.221e-74
Identity = 121/171 (70.76%), Postives = 132/171 (77.19%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            M KD++V E    SG  +A+DY DPPPAP  D EEL KW  YRAVIAEF+A            IGYK+QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFL RKVSL+R +LY+VAQCLGAICGCGFVKAFQ SYY RYGGGANELADGYN+
Sbjct:    1 MAKDLDVNE----SGPPAARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNK 167          

HSP 2 Score: 48.9062 bits (115), Expect = 7.221e-74
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGLGAEIIGTFVLVYTVFSATD
Sbjct:  167 KGTGLGAEIIGTFVLVYTVFSATD 190          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.228e-73
Identity = 125/173 (72.25%), Postives = 137/173 (79.19%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQ--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            MGKD EV E  G +GEF+AKDY DPPPAPLID  ELG WS YRAVIAEFIA            IGYK QTD + +     CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RA+LY+VAQCLGAICG G VKAFQ +Y+NRYGGGAN LA GY++
Sbjct:    1 MGKD-EVMESGGAAGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSK 172          

HSP 2 Score: 46.595 bits (109), Expect = 1.228e-73
Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGL AEIIGTFVLVYTVFSATD
Sbjct:  172 KGTGLAAEIIGTFVLVYTVFSATD 195          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP27_MAIZE (Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.089e-73
Identity = 122/172 (70.93%), Postives = 134/172 (77.91%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNL-NTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            M KDVE   +QG   E+SAKDYHDPPPAPLID +EL KWS YRA IAEFIA            IGYK Q+D  +    +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSL+RALLYM+AQC GAICG G  K FQKS+YNRYGGG N ++DGYN+
Sbjct:    1 MAKDVEQVTEQG---EYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLTIIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNK 169          

HSP 2 Score: 46.595 bits (109), Expect = 2.089e-73
Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GT LGAEIIGTFVLVYTVFSATD
Sbjct:  169 KGTALGAEIIGTFVLVYTVFSATD 192          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 3.554e-73
Identity = 122/175 (69.71%), Postives = 136/175 (77.71%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLN----TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            MGKD +V +   G GEF+AKDY DPPPAPL+D  ELG WS YRAVIAEFIA            IGYK QTD + +       CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL RKVSL+RALLYMVAQCLGA+CG G VKAFQ +Y++RYGGGAN LA GY+R
Sbjct:    1 MGKD-DVVQSGAGGGEFAAKDYTDPPPAPLVDAAELGSWSLYRAVIAEFIATLLFLYVTVATVIGYKHQTDASASGAGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSR 174          

HSP 2 Score: 46.595 bits (109), Expect = 3.554e-73
Identity = 21/24 (87.50%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +G GLGAEI+GTFVLVYTVFSATD
Sbjct:  174 RGAGLGAEIVGTFVLVYTVFSATD 197          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.341e-72
Identity = 123/173 (71.10%), Postives = 137/173 (79.19%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQ--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            M KD+E +  +  +GEFSAKDY DPPPAPLID EEL +WS YRAVIAEFIA            IGYK QTD + +     CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RALLY++AQCLGAICG G VK FQ +YY RYGGGANEL+DGY++
Sbjct:    1 MAKDIEASGPE--AGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSK 171          

HSP 2 Score: 46.595 bits (109), Expect = 1.341e-72
Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGL AEIIGTFVLVYTVFSATD
Sbjct:  171 KGTGLAAEIIGTFVLVYTVFSATD 194          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.463e-71
Identity = 121/170 (71.18%), Postives = 129/170 (75.88%), Query Frame = 2
Query:  101 MGKDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYN 610
            M KDVE    +G    F  +DY DPPPAP ID  EL KWSFYRAVIAEF+A            IGYK Q+D +     CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL RALLY++AQCLGAICG GFVKAFQ SYY RYGGGAN LADGY+
Sbjct:    1 MAKDVEAVPGEG----FQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYS 166          

HSP 2 Score: 46.2098 bits (108), Expect = 1.463e-71
Identity = 22/23 (95.65%), Postives = 22/23 (95.65%), Query Frame = 1
Query:  613 GTGLGAEIIGTFVLVYTVFSATD 681
            GTGL AEIIGTFVLVYTVFSATD
Sbjct:  168 GTGLAAEIIGTFVLVYTVFSATD 190          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.464e-71
Identity = 117/162 (72.22%), Postives = 127/162 (78.40%), Query Frame = 2
Query:  125 EQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYN 610
            E  G    FS KDY DPPP PL D  ELGKWSFYRA+IAEFIA            IGYKSQTDP LN DQC GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L RKV+L+RA++YMVAQCLGAICG   VKAFQ +Y+ RYGGGAN L+DGY+
Sbjct:    4 EVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYS 165          

HSP 2 Score: 45.0542 bits (105), Expect = 1.464e-71
Identity = 21/23 (91.30%), Postives = 22/23 (95.65%), Query Frame = 1
Query:  613 GTGLGAEIIGTFVLVYTVFSATD 681
            GTG+ AEIIGTFVLVYTVFSATD
Sbjct:  167 GTGVAAEIIGTFVLVYTVFSATD 189          
BLAST of FC868503 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.489e-71
Identity = 121/171 (70.76%), Postives = 135/171 (78.95%), Query Frame = 2
Query:  107 KDVEVAEQQGGSGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAXXXXXXXXXXXXIGYKSQTDPNLNTDQ--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNR 613
            +D+E +  +  +GEFSAKDY DPPPAPLID +EL KWS YRAVIAEFIA            IGYK QTD   +     CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RKVSL+RALLY++AQCLGAICG G VK FQ +YY RYGGGANEL+DGY++
Sbjct:    4 QDIEASGPE--AGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSK 172          

HSP 2 Score: 46.595 bits (109), Expect = 2.489e-71
Identity = 22/24 (91.67%), Postives = 23/24 (95.83%), Query Frame = 1
Query:  610 QGTGLGAEIIGTFVLVYTVFSATD 681
            +GTGL AEIIGTFVLVYTVFSATD
Sbjct:  172 KGTGLAAEIIGTFVLVYTVFSATD 195          
The following BLAST results are available for this feature:
BLAST of FC868503 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
PIP22_ORYSJ3.888e-7572.83Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]
PIP21_MAIZE4.245e-7471.68Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP24_ARATH7.221e-7470.76Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP21_ORYSJ1.228e-7372.25Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP27_MAIZE2.089e-7370.93Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1[more]
PIP22_MAIZE3.554e-7369.71Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP24_MAIZE1.341e-7271.10Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP21_ARATH1.463e-7171.18Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1... [more]
PIP25_ARATH1.464e-7172.22Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]
PIP23_MAIZE2.489e-7170.76Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001B11EF AbioticL1 Citrus clementina cDNA clone C31001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868503 ID=FC868503|Name=FC868503|organism=Citrus clementina|type=EST|length=681bp
CTTCCCCGGGGAGGATCATTAAACTCTGTAGCTCCACAACAGTCGTAGCT
CTTGTTTCTCCCTCTCGTTTAATTAACAAAACAAAAATAAAAGGGAAAAA
ATGGGGAAGGATGTTGAAGTTGCTGAGCAGCAAGGCGGCAGCGGCGAGTT
CTCAGCCAAGGACTACCACGACCCCCCTCCGGCGCCGCTGATCGATTTCG
AGGAGCTGGGCAAGTGGTCTTTTTACAGAGCTGTAATTGCTGAGTTCATC
GCTACGCTTTTGTTTCTTTATGTTACCGTCTTGACTGTGATTGGATACAA
GAGCCAGACTGATCCCAACTTGAATACCGATCAGTGTGGTGGCGTTGGCA
TTCTTGGCATCGCTTGGGCCTTTGGTGGCATGATCTTCATTCTCGTTTAC
TGCACAGCCGGTATTTCTGGTGGACATATCAACCCGGCTGTGACATTCGG
ACTGTTCTTGGGGCGCAAGGTGTCGCTCATCCGAGCTCTTTTGTACATGG
TAGCACAGTGCTTGGGTGCAATCTGTGGTTGTGGGTTTGTGAAGGCTTTC
CAAAAATCATACTACAACAGGTATGGAGGTGGGGCCAATGAGCTAGCTGA
TGGATACAACAGGGCACCGGACTGGGTGCTGAGATCATCGGTACTTTCGT
TCTTGTCTACACTGTTTTCTCTGCCACTGAT
back to top