FC868507

Overview
NameFC868507
Unique NameFC868507
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: AVP1_ARATH (Pyrophosphate-energized vacuolar membrane proton pump 1 OS=Arabidopsis thaliana GN=AVP1 PE=1 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.244e-111
Identity = 204/217 (94.01%), Postives = 208/217 (95.85%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 652
            LVSLALF AFVSRAGI TVDVLTPKV IGL+V AMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGT KPDYATCVKISTDASIKEMIPPG LVMLTPLIVG FFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAG SEHA++LGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGG+LFK F
Sbjct:  554 LVSLALFGAFVSRAGIHTVDVLTPKVIIGLLVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGFFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGVSEHAKSLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGILFKYF 770          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: AVP_PHAAU (Pyrophosphate-energized vacuolar membrane proton pump OS=Phaseolus aureus PE=1 SV=3)

HSP 1 Score: 397.897 bits (1021), Expect = 2.751e-110
Identity = 207/217 (95.39%), Postives = 210/217 (96.77%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 652
            LVSLALF AFVSRA ITTVDVLTPKVFIGLIV AMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGT KPDYATCVKISTDASIKEMIPPGALVMLTPL+VGI FGVETLSGVLAGSLVSGVQIAISASNT GAWDNAKKYIEAGASEHAR+LGPKGS+ HKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF
Sbjct:  550 LVSLALFGAFVSRASITTVDVLTPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLVVGILFGVETLSGVLAGSLVSGVQIAISASNT-GAWDNAKKYIEAGASEHARSLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: AVP_HORVU (Pyrophosphate-energized vacuolar membrane proton pump OS=Hordeum vulgare PE=2 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 7.492e-108
Identity = 200/215 (93.02%), Postives = 206/215 (95.81%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFK 646
            LVSLALF AFVSRAG+  VDVL+PKVFIGLIV AMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGT KPDYATCVKISTDASIKEMIPPGALVMLTPLIVG  FGVETLSGVLAG+LVSGVQIAISASNTGGAWDNAKKYIEAG SEHAR+LGPKGS+ HKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFAT+GGLLFK
Sbjct:  546 LVSLALFGAFVSRAGVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGTLFGVETLSGVLAGALVSGVQIAISASNTGGAWDNAKKYIEAGNSEHARSLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATYGGLLFK 760          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA_LEPIN (Pyrophosphate-energized proton pump OS=Leptospira interrogans GN=hppA PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.290e-75
Identity = 143/217 (65.90%), Postives = 174/217 (80.18%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 652
            L SLALFAAF++R   T+++VL  +VF GL+  AMLP+ F+AMTMKSVG AA+ MVEEVR+QF  IPG+MEG  KPDY  CV IST A+++EMI PG LV+LTP++VG  FGV+TL+GVLAG+LV+GV +AISA+N+GG WDNAKKYIE  A       G KGS+ HKAAV+GDT+GDP KDTSGPS+NILIKLMA+ SLVFA FF   GGL+FKIF
Sbjct:  494 LTSLALFAAFITRTHTTSLEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEIPGIMEGKNKPDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVKTLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKA-------GGKGSDQHKAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFFVQQGGLIFKIF 703          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA_LEPIC (Pyrophosphate-energized proton pump OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=hppA PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.290e-75
Identity = 143/217 (65.90%), Postives = 174/217 (80.18%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 652
            L SLALFAAF++R   T+++VL  +VF GL+  AMLP+ F+AMTMKSVG AA+ MVEEVR+QF  IPG+MEG  KPDY  CV IST A+++EMI PG LV+LTP++VG  FGV+TL+GVLAG+LV+GV +AISA+N+GG WDNAKKYIE  A       G KGS+ HKAAV+GDT+GDP KDTSGPS+NILIKLMA+ SLVFA FF   GGL+FKIF
Sbjct:  494 LTSLALFAAFITRTHTTSLEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEIPGIMEGKNKPDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVKTLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKA-------GGKGSDQHKAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFFVQQGGLIFKIF 703          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA_CLOTE (Pyrophosphate-energized proton pump OS=Clostridium tetani GN=hppA PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.210e-65
Identity = 123/216 (56.94%), Postives = 156/216 (72.22%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKI 649
            L +L+LFA++     + ++D+L     +GL + AMLP+ F A+TM+SVG AA +M+EEVRRQF TIPG+MEG   PDY  CV IST A+I+EMI PG L ++ P+ +G+  G E L G+LAG+LVSGV + I  SN GGAWDNAKKYIE GA       G KGSE HKAAV+GDT+GDP KDTSGPS+NILIKLM + SLVFAP    +GG+L  +
Sbjct:  462 LTALSLFASYAQATELESIDILNTVTLVGLFIGAMLPFLFGALTMESVGKAANEMIEEVRRQFKTIPGIMEGKATPDYKKCVDISTAAAIREMILPGVLAIVVPVAMGLLLGKEALGGLLAGALVSGVLVGILMSNAGGAWDNAKKYIEGGAH------GGKGSEAHKAAVVGDTVGDPFKDTSGPSMNILIKLMTIVSLVFAPVVLQYGGILLNL 671          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA1_METMA (Pyrophosphate-energized proton pump 1 OS=Methanosarcina mazei GN=hppA1 PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.523e-63
Identity = 116/206 (56.31%), Postives = 156/206 (75.73%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 619
            L +L+LFA++    G+T++DV+ P VFIGLI+ AMLP+ FS+MT+ +VG+AA ++V EVRRQF  I GLMEG   PDY+ C+ IST +++KEMIPPG L ++ P++VG+  G   L G+LAGS+VSG  +AI+ SN GG+WDNAKK+IE G        G KGS+ HKA V GDT+GDP KDT+GP++NILIKLM++ +LVFAP F
Sbjct:  476 LTALSLFASYAIAVGLTSIDVMNPNVFIGLIIGAMLPFLFSSMTILAVGNAAGEVVVEVRRQFKEIKGLMEGKADPDYSKCITISTHSALKEMIPPGILAVIAPILVGLVLGAGALGGLLAGSVVSGFMLAITMSNAGGSWDNAKKFIELG------NFGGKGSDAHKAGVTGDTVGDPFKDTAGPAINILIKLMSIVALVFAPLF 675          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA1_METAC (Pyrophosphate-energized proton pump 1 OS=Methanosarcina acetivorans GN=hppA1 PE=3 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 9.588e-63
Identity = 118/206 (57.28%), Postives = 152/206 (73.79%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 619
            L +LALFA++    G++ +DV+ P VFIGL + AMLPY FS+MT+ +VG+AA ++V EVRRQF  I GLMEG   PDY  C+ IST +++KEMIPPG L ++ PL+VG+  G   L G+LAGS+ SG  IAI+ SN GGAWDNAKKYIE G        G KGS+ HKA V GDT+GDP KDT+GP++NILIKLM++ ++VFAP F
Sbjct:  476 LTALALFASYGIAVGLSAIDVMNPNVFIGLTIGAMLPYLFSSMTILAVGNAAGEVVVEVRRQFREIAGLMEGKADPDYGKCIAISTHSALKEMIPPGLLAVIAPLLVGLVLGPGALGGLLAGSVASGFMIAITMSNAGGAWDNAKKYIELG------NFGGKGSDAHKAGVTGDTVGDPFKDTAGPAINILIKLMSIVAVVFAPLF 675          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA_FUSNN (Pyrophosphate-energized proton pump OS=Fusobacterium nucleatum subsp. nucleatum GN=hppA PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.902e-56
Identity = 114/211 (54.03%), Postives = 148/211 (70.14%), Query Frame = 2
Query:    2 LVSLALFAAFVSRAGITT-----VDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 619
            L +L+LFAA+       T     +DV  P+V  GL +  ML + FSA+TM +VG AA++MVEEVRRQF   PG+M+ T KPDY  CV+IST +S+K+MI PG L ++ P+I+G+ + V+ L G+LAG+LV+GV +AI  +N GGAWDN KK IE G          KGS+ HKAAV+GDT+GDP KDTSGPSLNILIKLM++ SLV  P F
Sbjct:  463 LTALSLFAAYKEAVDKLTSEALVIDVTDPEVIAGLFIGGMLTFLFSALTMTAVGKAAIEMVEEVRRQFREFPGIMDRTQKPDYKRCVEISTHSSLKQMILPGVLAIIVPVIIGL-WSVKALGGLLAGALVTGVLMAIMMANAGGAWDNGKKQIEGGYKG-----DKKGSDRHKAAVVGDTVGDPFKDTSGPSLNILIKLMSIVSLVLVPLF 667          
BLAST of FC868507 vs. ExPASy Swiss-Prot
Match: HPPA_CHLAA (Pyrophosphate-energized proton pump OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hppA PE=3 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 8.419e-51
Identity = 100/193 (51.81%), Postives = 138/193 (71.50%), Query Frame = 2
Query:   47 ITTVDVLTPKVFIGLIVEAMLPYWFSAMTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGIFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFAT 625
            + +++V  P VFIGL++   +P+ FSA+T+++V  AA ++V EVRRQF  IPGLMEG  +PDYA  V+IST A+ KE+I  G + ++ P+IVG   GVE L G LAG +++G  +A+  +N GGAWDNAKKYIE G        G K SEPHKAAV+GDT+GDPLKDT+GP+LN +IK++ + +L+ AP   T
Sbjct:  546 LASINVAAPPVFIGLLIGGAVPFLFSALTIRAVSRAAAQIVNEVRRQFR-IPGLMEGKVQPDYARAVQISTTAAQKELISLGLIAVMVPIIVGFTLGVEALGGFLAGIILTGQLMAVFQANAGGAWDNAKKYIEEG------NFGGKHSEPHKAAVVGDTVGDPLKDTAGPALNPMIKVINLVALIIAPIVVT 731          
The following BLAST results are available for this feature:
BLAST of FC868507 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
AVP1_ARATH4.244e-11194.01Pyrophosphate-energized vacuolar membrane proton p... [more]
AVP_PHAAU2.751e-11095.39Pyrophosphate-energized vacuolar membrane proton p... [more]
AVP_HORVU7.492e-10893.02Pyrophosphate-energized vacuolar membrane proton p... [more]
HPPA_LEPIN1.290e-7565.90Pyrophosphate-energized proton pump OS=Leptospira ... [more]
HPPA_LEPIC1.290e-7565.90Pyrophosphate-energized proton pump OS=Leptospira ... [more]
HPPA_CLOTE1.210e-6556.94Pyrophosphate-energized proton pump OS=Clostridium... [more]
HPPA1_METMA2.523e-6356.31Pyrophosphate-energized proton pump 1 OS=Methanosa... [more]
HPPA1_METAC9.588e-6357.28Pyrophosphate-energized proton pump 1 OS=Methanosa... [more]
HPPA_FUSNN3.902e-5654.03Pyrophosphate-energized proton pump OS=Fusobacteri... [more]
HPPA_CHLAA8.419e-5151.81Pyrophosphate-energized proton pump OS=Chloroflexu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001C04EF AbioticL1 Citrus clementina cDNA clone C31001C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868507 ID=FC868507|Name=FC868507|organism=Citrus clementina|type=EST|length=704bp
GTTGGTGTCTTTGGCTCTATTTGCTGCTTTTGTGAGCCGTGCTGGAATTA
CAACTGTTGATGTTTTGACCCCCAAGGTCTTCATTGGTCTGATTGTTGAG
GCCATGCTTCCTTACTGGTTCTCAGCCATGACAATGAAGAGTGTGGGAAG
TGCAGCTTTGAAGATGGTTGAGGAAGTCCGCAGACAGTTCAACACCATTC
CAGGTCTCATGGAGGGCACTACCAAGCCTGATTACGCTACCTGTGTTAAG
ATCTCAACCGATGCATCCATCAAGGAGATGATTCCTCCTGGTGCTCTTGT
CATGCTCACACCCCTCATTGTTGGAATCTTCTTTGGTGTGGAAACCCTTT
CTGGTGTGCTCGCTGGCTCCCTTGTTTCGGGTGTTCAGATAGCAATATCT
GCCTCCAACACTGGCGGTGCATGGGATAATGCCAAGAAATATATTGAGGC
TGGTGCCTCAGAGCATGCAAGGACCCTTGGCCCAAAGGGTTCTGAGCCAC
ACAAGGCAGCTGTGATTGGTGATACCATTGGAGATCCACTGAAGGATACG
TCAGGCCCATCTCTAAACATCCTCATCAAACTCATGGCCGTTGAATCACT
GGTGTTTGCTCCTTTCTTTGCCACCCACGGTGGNCTGCTTTTCAAGATCT
TCTGAAGAAGAGATAATGTGAAATACATTGCGGAAGAAGGTCATTGACTT
TTGC
back to top