FC868509

Overview
NameFC868509
Unique NameFC868509
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length722
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6173 contig Ccv1_Contig6173:28..749. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.676e-102
Identity = 186/214 (86.92%), Postives = 195/214 (91.12%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHD  +CA VTE VLAACYKALN+
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNE 214          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 370.163 bits (949), Expect = 6.370e-102
Identity = 185/214 (86.45%), Postives = 195/214 (91.12%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHD  +CA V+E VLAACYKALN+
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNE 214          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.319e-102
Identity = 184/214 (85.98%), Postives = 195/214 (91.12%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVE+NRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HD  +CA+V+ERVLAACYKALND
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALND 214          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.580e-98
Identity = 183/215 (85.12%), Postives = 190/215 (88.37%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HD HKCA +TERVLAA YKAL+D
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSD 215          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.769e-97
Identity = 183/215 (85.12%), Postives = 193/215 (89.77%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVE+NR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HD  KCA +TERVLAA YKAL+D
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSD 215          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.374e-96
Identity = 174/214 (81.31%), Postives = 190/214 (88.79%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+EANR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HD  KCA VTE VLAACYKALND
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALND 214          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 2.432e-85
Identity = 159/213 (74.65%), Postives = 174/213 (81.69%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALN 707
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN E+NR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HD  KCA VTE VLAA +KALN
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALN 213          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.530e-71
Identity = 143/211 (67.77%), Postives = 165/211 (78.20%), Query Frame = 3
Query:   87 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVPIVEPEIL+DG H   + A+VTE+VLAA +KALND
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALND 214          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.443e-69
Identity = 137/205 (66.83%), Postives = 160/205 (78.05%), Query Frame = 3
Query:   99 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD   C  VTE+VLAA YKAL+D
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSD 219          
BLAST of FC868509 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.167e-69
Identity = 136/205 (66.34%), Postives = 156/205 (76.10%), Query Frame = 3
Query:   99 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDXHKCADVTERVLAACYKALND 710
            EL +NA+ I  PGKG+LAADEST TIGKR ++IN+EN E NRRA RELLF T P   +++SGVILF ET+YQKT  GKPFV++L+E GVLPGIKVD G V L GT  E TTQGLD LAQRC +YY  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVPIVEPE+L DG HD      VTE+VL+  YKAL D
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLSFVYKALAD 219          
The following BLAST results are available for this feature:
BLAST of FC868509 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_MAIZE1.676e-10286.92Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ6.370e-10286.45Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_SPIOL8.319e-10285.98Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR5.580e-9885.12Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA2.769e-9785.12Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA1.374e-9681.31Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH2.432e-8574.65Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI1.530e-7167.77Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF2_LAMJA2.443e-6966.83Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALF_ECHMU4.167e-6966.34Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001C06EF AbioticL1 Citrus clementina cDNA clone C31001C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868509 ID=FC868509|Name=FC868509|organism=Citrus clementina|type=EST|length=722bp
GGCATAAAAATCGCTCTCTCTGTTTCTCCCTCTAACAAAACAAATTTTCT
ATCTTCAAGTAGATCACCATGTCTTGCTTCAAGGGCAAATACGCCGATGA
GCTCATTAAAAACGCTGCCTACATTGGCACCCCTGGAAAGGGTATCCTTG
CTGCTGATGAGTCAACAGGCACCATTGGCAAGCGTCTATCCAGCATCAAT
GTTGAGAATGTTGAGGCAAACAGGCGTGCTCTCCGCGAGCTCCTTTTCTG
CACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTCATCCTCTTCGAGGAGA
CCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTTTGTTGATGTCTTGAAG
GAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACAAGGGTACTGTTGAGCT
TGCTGGTACCAATGGTGAGACCACCACCCAGGGTCTTGATGGCCTCGCCC
AGCGCTGCCAGAAATACTATGAAGCTGGTGCTCGTTTTGCCAAATGGCGT
GCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGCAGCTGGCCATCAATGA
GAATGCCAATGGCCTGGCCCGATATGCTATCATCTGCCAGGAGAATGGCC
TTGTTCCCATTGTTGAACCTGAGATCCTTGTTGACGGTCCCCATGACATN
CACAAGTGTGCTGATGTGACCGAGCGTGTTCTTGCTGCATGCTACAAGGC
TCTGAATGACACCATGTCCTTC
back to top