FC868538

Overview
NameFC868538
Unique NameFC868538
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length616
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868538 vs. ExPASy Swiss-Prot
Match: Y575_SYNY3 (Thylakoid membrane protein slr0575 OS=Synechocystis sp. (strain PCC 6803) GN=slr0575 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.854e-11
Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 2
Query:  395 YGFPLAVIGMALKYAELKPVPCL--TYSDAQSLRETCATPILKQVRNDVIRFRYGDEQHLDEALKRI 589
            YG PL + G+ALK AELKP+P    T     +LR   ATP   Q+R DV R+RYG E HLDE+L+R+
Sbjct:   40 YGIPLVLGGLALKAAELKPIPFSQPTSEKIIALRNQLATPTQNQIRKDVTRYRYGQEAHLDESLERL 106          
The following BLAST results are available for this feature:
BLAST of FC868538 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y575_SYNY33.854e-1152.24Thylakoid membrane protein slr0575 OS=Synechocysti... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31001F07EF AbioticL1 Citrus clementina cDNA clone C31001F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868538 ID=FC868538; Name=FC868538; organism=Citrus clementina; type=EST; length=616bp
AAAAGAGAAATTCGAAAGCTAAGAAGCAATGCAAACGTTAACTTTAACGA
GAGCAACAAATTTGTTTTCGCAGCATCAAGATGATCGTTACTTAGGCTTA
TCCAATCACCGCCTTTGCTTTCTCTCCGTTCATCCTGCTTCTCCGCCTCC
GCTTCTCGCCTCGAAACGACACCGTTTGAAACTCGCCTTCGTCGCCAAGG
CCGCAGATTCGACACAACCTTCCTCGGCTACTACCTCTGCCGACAAGACG
CTTGTTCCCGATGACGAATTCACTCTCGCTAAGGTTTCATTTGGTGTTAT
TGGACTAGGTCTTGGAATTTCACTCTTGTCGTACGGTTTTGGGGCTTACT
TCAGTATTTTCCCCGGATCTGAATGGTCAGCGTTAATGCTTACATATGGC
TTCCCTCTCGCCGTAATTGGAATGGCACTTAAGTATGCAGAACTGAAACC
AGTCCCATGCTTGACTTATTCAGATGCTCAAAGTTTAAGGGAAACATGCG
CCACTCCAATCCTTAAACAGGTCAGGAATGATGTTATAAGATTTCGTTAT
GGGGATGAGCAGCATCTGGATGAGGCATTGAAAAGGATTTTCCAATATGG
CTTGGGTGGAGGAATT
back to top