FC868539

Overview
NameFC868539
Unique NameFC868539
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig17 contig Ccv1_Contig17:112..787. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CRD1_EUPES (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Euphorbia esula GN=CRD1 PE=3 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 6.921e-84
Identity = 165/213 (77.46%), Postives = 172/213 (80.75%), Query Frame = 3
Query:   30 MAAEMALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCTIXXXXXXXXXXXXXXXXXXXXXNKTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            MAAEMALVKPI+          P+F  P  T +S S++F TI                     NK  I ETLLTPRFYTTDFDEMETLFNTEINKKLNQ+EFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGF+TKARKYTF
Sbjct:    1 MAAEMALVKPIT----------PKFINPMRTFSS-SSKFSTIKMSATSQSNTTTTATKPSKKGNKKEINETLLTPRFYTTDFDEMETLFNTEINKKLNQSEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFLTKARKYTF 202          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CRD1_GOSHI (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Gossypium hirsutum GN=CRD1 PE=2 SV=2)

HSP 1 Score: 297.745 bits (761), Expect = 3.554e-80
Identity = 160/217 (73.73%), Postives = 170/217 (78.34%), Query Frame = 3
Query:   30 MAAEMALVKPISKFST----IATTTKPRFSYPKATCTSLSTRFCTIXXXXXXXXXXXXXXXXXXXXXNKTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            MA EMALVKPISKFST     + +   +F+  + + TS ST                           KTAIKETLLTPRFYTTDFDEME LFNTEINK LNQ+EFE+LLQEFKTDYNQTHFVRNKEFKEAADK+ GPLRQIFVEF ERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFN ALDLGF+TKARKYTF
Sbjct:    1 MATEMALVKPISKFSTSSPIFSNSRYGKFTTVRMSSTSQSTTKAAAKGGKKAA---------------KTAIKETLLTPRFYTTDFDEMEALFNTEINKNLNQSEFESLLQEFKTDYNQTHFVRNKEFKEAADKIDGPLRQIFVEFSERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTF 202          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CRD1_ARATH (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Arabidopsis thaliana GN=CRD1 PE=2 SV=2)

HSP 1 Score: 295.819 bits (756), Expect = 1.351e-79
Identity = 160/214 (74.77%), Postives = 169/214 (78.97%), Query Frame = 3
Query:   30 MAAEMALVKPISKFSTIATTTKPRFSYPKATCTSLSTRFCT-IXXXXXXXXXXXXXXXXXXXXXNKTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            MAAEMALVKPISKFS+      P+ S P    +    RF T I                      K  I+E+LLTPRFYTTDF+EME LFNTEINK LN+AEFEALLQEFKTDYNQTHFVRNKEFKEAADK+QGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFN ALDLGF+TKARKYTF
Sbjct:    1 MAAEMALVKPISKFSS------PKLSNPSKFLSG--RRFSTVIRMSASSSPPPPTTATSKSKKGTKKEIQESLLTPRFYTTDFEEMEQLFNTEINKNLNEAEFEALLQEFKTDYNQTHFVRNKEFKEAADKLQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTF 206          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CRD1_HORVU (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic OS=Hordeum vulgare GN=CRD1 PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.806e-74
Identity = 136/149 (91.28%), Postives = 142/149 (95.30%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            KT + E+LLTPRFYTTDFDEME LFN EINK+LNQ EF+ALLQEFKTDYNQTHF+RN EFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFN ALDLGF+TKARKYTF
Sbjct:   66 KTEVNESLLTPRFYTTDFDEMEQLFNAEINKQLNQDEFDALLQEFKTDYNQTHFIRNPEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTF 214          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CTH1_CHLRE (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 2, chloroplastic OS=Chlamydomonas reinhardtii GN=CTH1 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.227e-64
Identity = 119/149 (79.87%), Postives = 132/149 (88.59%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            K A  ETLLTPRFYTTDFDEME LF+ E+NK ++  EFEA+L EFK DYNQ HFVRN+ FKEAA+K+QGP R+IF+EFLERSCTAEFSGFLLYKELGRRLK TNPVVAEIF+LMSRDEARHAGFLNK +SDFN ALDLGF+TK RKYTF
Sbjct:   56 KVASDETLLTPRFYTTDFDEMERLFSLELNKNMDMEEFEAMLNEFKLDYNQRHFVRNETFKEAAEKIQGPTRKIFIEFLERSCTAEFSGFLLYKELGRRLKATNPVVAEIFTLMSRDEARHAGFLNKAMSDFNLALDLGFLTKNRKYTF 204          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: CRD1_CHLRE (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=CRD1 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.522e-57
Identity = 108/149 (72.48%), Postives = 122/149 (81.88%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            K A KETLLTPRFYTTDFDEME LF+ EIN  L+  E  A L EF+ DYN+ HFVRN+ FK AADK+ G  R+IF+EFLERSCTAEFSGFLLYKEL RR+K ++P VAE+F LMSRDEARHAGFLNK LSDFN ALDLGF+TK R YT+
Sbjct:   56 KVAAKETLLTPRFYTTDFDEMEQLFSKEINPNLDMEELNACLNEFRNDYNKVHFVRNETFKAAADKVTGETRRIFIEFLERSCTAEFSGFLLYKELARRMKASSPEVAEMFLLMSRDEARHAGFLNKALSDFNLALDLGFLTKNRTYTY 204          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: ACSF1_SYNY3 (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 1 OS=Synechocystis sp. (strain PCC 6803) GN=acsF1 PE=3 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.838e-52
Identity = 100/149 (67.11%), Postives = 121/149 (81.21%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            KT  KET+LTPRFYTTDFDEM      +++   N+ E  A+L+EF+ DYN+ HFVRN+ F ++ D + G  RQ+FVEFLERSCTAEFSGFLLYKELGRRLK  NP++AE F+LMSRDEARHAGFLNK +SDFN +LDLGF+TK+RKYTF
Sbjct:   18 KTPAKETILTPRFYTTDFDEM-----AKMDISPNEDELRAILEEFRVDYNRHHFVRNESFNKSWDHIDGEKRQLFVEFLERSCTAEFSGFLLYKELGRRLKNKNPLLAECFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTF 161          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: ACSF_TRIEI (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Trichodesmium erythraeum (strain IMS101) GN=acsF PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.348e-52
Identity = 98/149 (65.77%), Postives = 122/149 (81.88%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            K   KET+LTPRFYTTDFDEM      +++  +N+ E  A+L+EF+ DYN+ HFVRN+EF ++ D + G  R++FVEFLERSCTAEFSGFLLYKELGRRLK  +P++AE F+LMSRDEARHAGFLNK +SDFN +LDLGF+TK+RKYTF
Sbjct:   18 KVPAKETILTPRFYTTDFDEM-----AKMDISVNEDELMAILEEFRADYNRHHFVRNEEFAQSWDHIDGETRRLFVEFLERSCTAEFSGFLLYKELGRRLKNKSPILAECFTLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTF 161          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: ACSF_GRATL (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase OS=Gracilaria tenuistipitata var. liui GN=acsF PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.348e-52
Identity = 99/150 (66.00%), Postives = 125/150 (83.33%), Query Frame = 3
Query:  219 NKTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            ++T +KETLLTPRFYTTDFDEM  L   +I+  ++  EFEALLQEF+ DYN+ HF+R++EF+++ + +    + +FVEFLERSCTAEFSGFLLYKEL R+L K+NPV+AE F LMSRDEARHAGFLNK +SDFN +LDLGF+TK+RKYTF
Sbjct:    8 SQTPVKETLLTPRFYTTDFDEMSKL---DISSNID--EFEALLQEFRADYNRQHFIRDQEFEQSWNNLDSGTKALFVEFLERSCTAEFSGFLLYKELSRKLDKSNPVIAECFLLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTF 152          
BLAST of FC868539 vs. ExPASy Swiss-Prot
Match: ACSF3_ANASP (Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase 3 OS=Anabaena sp. (strain PCC 7120) GN=acsF3 PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.654e-51
Identity = 99/149 (66.44%), Postives = 121/149 (81.21%), Query Frame = 3
Query:  222 KTAIKETLLTPRFYTTDFDEMETLFNTEINKKLNQAEFEALLQEFKTDYNQTHFVRNKEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLNKGLSDFNYALDLGFVTKARKYTF 668
            K   KETLLTPRFYTTDFDEM       ++  +N+ E  A+L+EF+TDYN+ HFVR+ EF+++ D + G  R++FVEFLERSCTAEFSGFLLYKELGRRLK  +PV+AE F+LMSRDEARHAGFLNK +SDFN +LDLGF+TK+R YTF
Sbjct:   18 KVPAKETLLTPRFYTTDFDEM-----ARMDISVNEDELLAILEEFRTDYNRHHFVRDAEFEKSWDHIDGDTRRLFVEFLERSCTAEFSGFLLYKELGRRLKDKSPVLAECFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRNYTF 161          
The following BLAST results are available for this feature:
BLAST of FC868539 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
CRD1_EUPES6.921e-8477.46Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
CRD1_GOSHI3.554e-8073.73Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
CRD1_ARATH1.351e-7974.77Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
CRD1_HORVU3.806e-7491.28Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
CTH1_CHLRE1.227e-6479.87Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
CRD1_CHLRE5.522e-5772.48Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
ACSF1_SYNY31.838e-5267.11Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
ACSF_TRIEI5.348e-5265.77Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
ACSF_GRATL5.348e-5266.00Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]
ACSF3_ANASP2.654e-5166.44Magnesium-protoporphyrin IX monomethyl ester [oxid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001F08EF AbioticL1 Citrus clementina cDNA clone C31001F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868539 ID=FC868539|Name=FC868539|organism=Citrus clementina|type=EST|length=676bp
ACTCTCTAGTTCCTCCCCTGGTTCCAGAAATGGCAGCTGAGATGGCACTG
GTCAAACCGATTAGCAAATTCAGCACCATCGCCACCACTACTAAGCCTAG
GTTCAGCTACCCGAAAGCAACATGTACATCTCTGAGCACAAGATTTTGTA
CAATCAAAATGTCAGCAACTTCAGAGCAAGCGGCTGCTGCCACTGCCCAA
AAGCCAAGCAAGAAATCAAACAAAACTGCTATCAAGGAGACCCTTCTGAC
ACCAAGGTTTTATACAACAGATTTTGATGAAATGGAGACCCTTTTCAACA
CTGAGATCAACAAGAAGCTCAACCAGGCTGAATTTGAGGCATTGCTTCAA
GAATTCAAGACTGATTATAACCAGACTCACTTTGTGAGGAACAAGGAGTT
CAAGGAAGCTGCTGACAAGATGCAAGGCCCTCTCAGGCAGATCTTTGTTG
AGTTCTTGGAGAGGTCTTGCACTGCTGAGTTCTCTGGTTTCCTTCTTTAC
AAAGAGCTCGGAAGGAGACTCAAGAAAACCAACCCAGTGGTAGCTGAGAT
TTTCTCTCTGATGTCCAGGGATGAAGCCAGGCATGCCGGGTTTCTGAACA
AGGGGCTATCTGATTTCAATTATGCATTGGACTTGGGCTTCGTGACNAAA
GCTAGGAAATACACATTTGTCAGCCA
back to top