FC868542

Overview
NameFC868542
Unique NameFC868542
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length681
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7340 contig Ccv1_Contig7340:1150..1831. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH2_ORYSJ (Cell division protease ftsH homolog 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 2.659e-107
Identity = 194/219 (88.58%), Postives = 201/219 (91.78%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQV+VDVPD+RGRTEILKVHGSNKKFD DVSL+VIAMRTPGFSG              GRRG+ AISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTL+PRGQARGLTWFIP DDPTLIS+QQLFARIVGGLGGRAAEE+IFG PEVT
Sbjct:  329 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVSVDVPDVRGRTEILKVHGSNKKFDTDVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGRTAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLIPRGQARGLTWFIPMDDPTLISRQQLFARIVGGLGGRAAEEIIFGEPEVT 547          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH8_ARATH (Cell division protease ftsH homolog 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.365e-103
Identity = 188/219 (85.84%), Postives = 198/219 (90.41%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTG+IV+AATNRADILDSALLRPGRFDRQV+VDVPD++GRT+ILKVH  NKKF++ VSL+VIAMRTPGFSG              GRRGK AISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHD VQKVTL+PRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFG  EVT
Sbjct:  335 GNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSALLRPGRFDRQVSVDVPDVKGRTDILKVHSGNKKFESGVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGKTAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGESEVT 553          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH2_ARATH (Cell division protease ftsH homolog 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 6.777e-103
Identity = 184/219 (84.02%), Postives = 197/219 (89.95%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTG+IV+AATNRADILDSALLRPGRFDRQV+VDVPD++GRT+ILKVH  NKKFD DVSL++IAMRTPGFSG              GRR + +ISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHA+CGTLTPGHD VQKVTL+PRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEE+IFG  EVT
Sbjct:  342 GNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSALLRPGRFDRQVSVDVPDVKGRTDILKVHAGNKKFDNDVSLEIIAMRTPGFSGADLANLLNEAAILAGRRARTSISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAVCGTLTPGHDAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGDSEVT 560          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH6_ARATH (Cell division protease ftsH homolog 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 3.371e-94
Identity = 172/219 (78.54%), Postives = 186/219 (84.93%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQ+LTEMDGF GNTG+IVIAATNR +ILDSALLRPGRFDRQV+V +PDIRGR EILKVH  +KK D DVSL VIAMRTPGFSG              GRRGK  I+  EIDDSIDRIVAGMEGT M DGKSK++VAYHEVGHAIC TLT GHDPVQKVTLVPRGQARGLTWF+P +DPTL+SKQQLFARIVGGLGGRAAE+VIFG PE+T
Sbjct:  339 GNDEREQTLNQILTEMDGFAGNTGVIVIAATNRPEILDSALLRPGRFDRQVSVGLPDIRGREEILKVHSRSKKLDKDVSLSVIAMRTPGFSGADLANLMNEAAILAGRRGKDKITLTEIDDSIDRIVAGMEGTKMIDGKSKAIVAYHEVGHAICATLTEGHDPVQKVTLVPRGQARGLTWFLPGEDPTLVSKQQLFARIVGGLGGRAAEDVIFGEPEIT 557          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH6_ORYSJ (Cell division protease ftsH homolog 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 7.527e-86
Identity = 159/221 (71.95%), Postives = 181/221 (81.90%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTG-IIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIP-SDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGF G  G ++VIAATNR +ILD+ALLRPGRFDR+V+V +PD+RGR EIL VHG+NK+ D  VSL V+AMRTPGFSG              GRRGK  I+  EIDDSIDRIVAG+EGT MTDGKSK LVAYHE+GHA+C TLT GHD VQKVTL+PRGQARGLTWF+P  +DP L+S+QQ+FA IVGGLGGRAAEEV+FG PEVT
Sbjct:  336 GNDEREQTLNQLLTEMDGFGGGDGGVVVIAATNRPEILDAALLRPGRFDRRVSVGLPDVRGREEILLVHGANKRLDPGVSLAVVAMRTPGFSGADLANLMNEAAILAGRRGKDRITVSEIDDSIDRIVAGLEGTSMTDGKSKMLVAYHEIGHAVCATLTAGHDEVQKVTLIPRGQARGLTWFLPGEEDPALVSRQQIFAGIVGGLGGRAAEEVVFGEPEVT 556          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH_PORPU (Cell division protease ftsH homolog OS=Porphyra purpurea GN=ftsH PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 8.322e-85
Identity = 157/219 (71.69%), Postives = 176/219 (80.37%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTG+IVIAATNRADILDSALLRPGRFDRQV+VDVPD RGR  IL+VH  NKK ++ VSL+ IA RTPGFSG               RR K+A++  EID SIDR+VAG+EGT + D KSK L+AYHEVGHAI G+L   HDPVQKVTL+PRGQARGLTWF PSDD +LIS+ Q+ ARIVG LGGRAAEE+IFG  EVT
Sbjct:  288 GNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVSVDVPDFRGRLAILEVHAKNKKMESKVSLETIARRTPGFSGADLANLLNEAAILTARRRKSAMTMSEIDTSIDRVVAGLEGTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPVQKVTLIPRGQARGLTWFTPSDDQSLISRSQILARIVGALGGRAAEEIIFGDAEVT 506          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FSTH_PORYE (Cell division protease ftsH homolog OS=Porphyra yezoensis GN=ftsH PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.162e-84
Identity = 157/219 (71.69%), Postives = 174/219 (79.45%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTG+IVIAATNRADILDSALLRPGRFDRQV+VDVPD +GR  IL+VH  NKK +  VSL+ IA RTPGFSG               RR K A++  EID SIDR+VAGMEGT + D KSK L+AYHEVGHAI G+L   HDPVQKVTL+PRGQARGLTWF PSDD +LIS+ Q+ ARIVG LGGRAAEE+IFG  EVT
Sbjct:  288 GNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPGFSGADLANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPVQKVTLIPRGQARGLTWFTPSDDQSLISRSQILARIVGALGGRAAEEIIFGDAEVT 506          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH_GUITH (Cell division protease ftsH homolog OS=Guillardia theta GN=ftsH PE=3 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 5.394e-84
Identity = 153/219 (69.86%), Postives = 174/219 (79.45%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTGII+IAATNR D+LD+ALLRPGRFDRQVTVDVPD++GR EIL VH  NKK D  +SL++IA RTPGFSG               RR K  I+  EID SIDR++AGMEG  + D K+K L+AYHEVGHAI GTL   HDPVQKVTLVPRGQA+GLTWF PS+D +LIS+ Q+ ARI+G LGGRAAEEV+FG PEVT
Sbjct:  288 GNDEREQTLNQLLTEMDGFEGNTGIIIIAATNRVDVLDAALLRPGRFDRQVTVDVPDVKGRLEILNVHARNKKLDLSISLELIAKRTPGFSGADLANLLNEAAILTARRRKKQITISEIDASIDRVIAGMEGKALVDSKTKRLIAYHEVGHAIIGTLLKHHDPVQKVTLVPRGQAKGLTWFTPSEDQSLISRSQILARIMGALGGRAAEEVVFGLPEVT 506          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH1_SYNY3 (Cell division protease ftsH homolog 1 OS=Synechocystis sp. (strain PCC 6803) GN=slr0228 PE=3 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.726e-80
Identity = 148/219 (67.58%), Postives = 169/219 (77.17%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGNTGII+IAATNR D+LDSAL+RPGRFDRQV VD PD  GR EIL+VH  NKK   +VS+D IA RTPGFSG               RR K+AI+  EIDD++DR+VAGMEGT + D KSK L+AYHEVGHAI GTL   HDPVQKVTL+PRGQA+GLTWF P+++  L +K QL ARI G +GGRAAEE +FG  EVT
Sbjct:  287 GNDEREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVMVDAPDYSGRKEILEVHARNKKLAPEVSIDSIARRTPGFSGADLANLLNEAAILTARRRKSAITLLEIDDAVDRVVAGMEGTPLVDSKSKRLIAYHEVGHAIVGTLLKDHDPVQKVTLIPRGQAQGLTWFTPNEEQGLTTKAQLMARIAGAMGGRAAEEEVFGDDEVT 505          
BLAST of FC868542 vs. ExPASy Swiss-Prot
Match: FTSH2_SYNY3 (Cell division protease ftsH homolog 2 OS=Synechocystis sp. (strain PCC 6803) GN=slr1390 PE=3 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.345e-79
Identity = 145/219 (66.21%), Postives = 169/219 (77.17%), Query Frame = 2
Query:    2 GNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGXXXXXXXXXXXXXXGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVT 658
            GNDEREQTLNQLLTEMDGFEGN+GIIVIAATNR D+LD ALLRPGRFDRQVTVD PD++GR  IL +H  NKK   +V L  IA RTPGF+G               RR K AI+  E++D+IDR+VAGMEGT + D KSK L+AYHEVGHA+ GTL PGHDPV+KVTL+PRGQA+GLTWF P +D +L+++ Q+ ARI G LGGR AEEVIFG  EVT
Sbjct:  326 GNDEREQTLNQLLTEMDGFEGNSGIIVIAATNRPDVLDLALLRPGRFDRQVTVDYPDVQGRELILAIHAQNKKLHEEVQLAAIARRTPGFTGADLANVLNEAAIFTARRRKEAITMAEVNDAIDRVVAGMEGTPLVDSKSKRLIAYHEVGHALIGTLCPGHDPVEKVTLIPRGQAQGLTWFTPDEDQSLMTRNQMIARIAGLLGGRVAEEVIFGDDEVT 544          
The following BLAST results are available for this feature:
BLAST of FC868542 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 256
Match NameE-valueIdentityDescription
FTSH2_ORYSJ2.659e-10788.58Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH8_ARATH1.365e-10385.84Cell division protease ftsH homolog 8, chloroplast... [more]
FTSH2_ARATH6.777e-10384.02Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH6_ARATH3.371e-9478.54Cell division protease ftsH homolog 6, chloroplast... [more]
FTSH6_ORYSJ7.527e-8671.95Cell division protease ftsH homolog 6, chloroplast... [more]
FTSH_PORPU8.322e-8571.69Cell division protease ftsH homolog OS=Porphyra pu... [more]
FSTH_PORYE3.162e-8471.69Cell division protease ftsH homolog OS=Porphyra ye... [more]
FTSH_GUITH5.394e-8469.86Cell division protease ftsH homolog OS=Guillardia ... [more]
FTSH1_SYNY34.726e-8067.58Cell division protease ftsH homolog 1 OS=Synechocy... [more]
FTSH2_SYNY32.345e-7966.21Cell division protease ftsH homolog 2 OS=Synechocy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001F12EF AbioticL1 Citrus clementina cDNA clone C31001F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868542 ID=FC868542|Name=FC868542|organism=Citrus clementina|type=EST|length=681bp
AGGGAATGATGAAAGAGAGCAGACCCTTAACCAGCTTTTGACAGAAATGG
ATGGTTTTGAGGGTAATACTGGTATCATTGTGATTGCTGCAACTAACAGG
GCGGACATTCTTGATTCTGCCTTATTGAGGCCTGGACGTTTTGATAGACA
GGTTACTGTTGATGTTCCTGACATTCGAGGAAGAACAGAGATATTAAAGG
TTCACGGTAGCAACAAGAAGTTTGATGCAGATGTGTCTCTTGATGTGATA
GCCATGAGAACACCTGGGTTCAGTGGTGCTGACCTTGCAAACCTCTTAAA
TGAGGCTGCTATATTGGCTGGACGACGTGGGAAAGCTGCTATTTCATCTA
AAGAGATTGATGATTCGATTGATAGGATTGTGGCTGGAATGGAAGGAACT
GTCATGACAGATGGGAAGAGTAAAAGTCTTGTTGCATACCATGAAGTTGG
CCACGCAATATGCGGAACTTTGACTCCTGGACACGATCCCGTTCAAAAAG
TCACCCTTGTTCCACGTGGTCAGGCAAGAGGTCTTACCTGGTTCATCCCT
TCAGATGACCCCACCTTGATATCGAAGCAGCAGCTCTTTGCAAGAATTGT
TGGTGGACTCGGTGGTAGAGCTGCTGAGGAAGTGATTTTTGGAGGGCCTG
AAGTGACACAGGAGCAGCTGGTGATTTGCAG
back to top