FC868546

Overview
NameFC868546
Unique NameFC868546
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length552
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9445 contig Ccv1_Contig9445:586..1138. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_PEA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.715e-86
Identity = 145/182 (79.67%), Postives = 164/182 (90.11%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR FVDHP FL +VWGKT SK+YGP+TG DY+DNQLRF +LCQAALEAPR+LNLNS+KYFSGPYGEDV+FVANDWH++LIPCYLK+MYK +G+YK+AKV FCIHNIAYQGR AF DF LLNLP +F+SSFDFIDGYNKP  G+KINWMKAGILESD V TVSPHYA+E +SGED GVELDNI
Sbjct:  155 DRVFVDHPLFLERVWGKTGSKLYGPKTGIDYRDNQLRFSLLCQAALEAPRVLNLNSSKYFSGPYGEDVIFVANDWHSALIPCYLKSMYKSRGLYKNAKVAFCIHNIAYQGRNAFSDFSLLNLPDEFRSSFDFIDGYNKPCEGKKINWMKAGILESDQVFTVSPHYAKELISGEDRGVELDNI 336          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 4.672e-84
Identity = 145/182 (79.67%), Postives = 158/182 (86.81%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR FVDHP FL KVWGKT+SKIYGP  G DYQDNQLRF +LCQAALEAPR+LNL S+KYFSGPYGEDVVFVANDWHT+L+PCYLK+MY+ KGMY  AKV FCIHNIAYQGRF   DF LLNLP QFKSSFDF DGY KPV+GRKINWMKAGILESD V+TVSP+YA E VSG + GVELDN+
Sbjct:  160 DRVFVDHPIFLEKVWGKTKSKIYGPNAGTDYQDNQLRFSLLCQAALEAPRVLNLTSSKYFSGPYGEDVVFVANDWHTALLPCYLKSMYQSKGMYLHAKVAFCIHNIAYQGRFGSSDFCLLNLPDQFKSSFDFFDGYEKPVKGRKINWMKAGILESDRVVTVSPYYAMELVSGAEKGVELDNV 341          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 7.969e-84
Identity = 144/181 (79.56%), Postives = 159/181 (87.85%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDN 549
            DR FVDHP FL KVWGKT SKIYGPR G DYQDNQLRF +LC AALEAPR+LNLNS+K FSGPYGE+V F+ANDWHT+L+PCYLKA+Y+P G+YK AKV FCIHNIAYQGRFAF DF  LNLP +FKSSFDFIDGY KPV+GRKINWMKAGILESD VLTVSP+YAQE +SG + GVELDN
Sbjct:  160 DRVFVDHPMFLEKVWGKTGSKIYGPRAGLDYQDNQLRFSLLCLAALEAPRVLNLNSSKNFSGPYGEEVAFIANDWHTALLPCYLKAIYQPMGIYKHAKVAFCIHNIAYQGRFAFSDFPRLNLPDKFKSSFDFIDGYEKPVKGRKINWMKAGILESDRVLTVSPYYAQEVISGVERGVELDN 340          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 2.834e-81
Identity = 141/179 (78.77%), Postives = 159/179 (88.83%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVEL 543
            DR FVDHP FLAKV GKT SKIYGP TG DY DNQLRF +LCQAALEAP++LNLNS+KYFSGPYGEDVVFVANDWHT+L+PCYLK+MY+ +G+Y +AKVVFCIHNIAYQGRFAF+D+ LLNLP  FKSSFDF+DGY KPV+GRKINWMKA ILE+  VLTVSP+YAQE +SG D GVEL
Sbjct:  162 DRVFVDHPIFLAKVVGKTGSKIYGPITGVDYNDNQLRFSLLCQAALEAPQVLNLNSSKYFSGPYGEDVVFVANDWHTALLPCYLKSMYQSRGVYMNAKVVFCIHNIAYQGRFAFDDYSLLNLPISFKSSFDFMDGYEKPVKGRKINWMKAAILEAHRVLTVSPYYAQELISGVDRGVEL 340          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 4.834e-81
Identity = 137/182 (75.27%), Postives = 159/182 (87.36%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR FVDHP FL KVWGKT SKIYGP+ G DY DN+LRF +LCQAALEAP++LNLNS+ YFSGPYGEDV+F+ANDWHT+LIPCYLK+MY+ +G+Y +AKV FCIHNIAYQGRF+F DF LLNLP +F+ SFDFIDGY KPV+GRKINWMKAGILES  V+TVSP+YAQE VS  D GVELD++
Sbjct:  159 DRVFVDHPMFLEKVWGKTGSKIYGPKAGLDYLDNELRFSLLCQAALEAPKVLNLNSSNYFSGPYGEDVLFIANDWHTALIPCYLKSMYQSRGIYLNAKVAFCIHNIAYQGRFSFSDFPLLNLPDEFRGSFDFIDGYEKPVKGRKINWMKAGILESHRVVTVSPYYAQELVSAVDKGVELDSV 340          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 8.246e-81
Identity = 137/181 (75.69%), Postives = 157/181 (86.74%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDN 549
            DR FVDHP FL KVWGKT S +YGP+ G+DY+DNQLRF +LCQAALEAPR+LNLNS+ YFSGPYGEDVVFVANDWHT+L+PCYLK MY+ +G+Y +AKV FCIHNIAYQGRFAF DF LLNLP ++K SFDFIDGY+KPV+GRKINWMKAGI E+D V TVSP+YA+E VS    GVELDN
Sbjct:  160 DRVFVDHPMFLEKVWGKTGSMLYGPKAGKDYKDNQLRFSLLCQAALEAPRVLNLNSSNYFSGPYGEDVVFVANDWHTALLPCYLKTMYQSRGIYMNAKVAFCIHNIAYQGRFAFSDFSLLNLPDEYKGSFDFIDGYDKPVKGRKINWMKAGIREADRVFTVSPNYAKELVSCVSKGVELDN 340          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_HORVU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Hordeum vulgare GN=WAXY PE=1 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.933e-78
Identity = 134/182 (73.63%), Postives = 155/182 (85.16%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR F+DHP FL KV GKT+ KIYGP  G DY+DNQ RF +LCQAALEAPRILNLN+N YFSGPYGEDVVFV NDWHT L+ CYLK+ Y+  G+Y++AKV FCIHNI+YQGRF+F+DF  LNLP +FKSSFDFIDGY+KPV GRKINWMKAGIL++D VLTVSP+YA+E +SGE  G ELDNI
Sbjct:  154 DRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNI 335          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 6.534e-78
Identity = 134/182 (73.63%), Postives = 151/182 (82.97%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR F+DHP FL +VWGKT+ KIYGP  G DY+DNQLRF +LCQAALEAPRIL+LN+N YFSGPYGEDVVFV NDWHT  + CYLK+ Y+  G+YK AK  FCIHNI+YQGRFAF DF  LNLP +FKSSFDFIDGY KPV GRKINWMKAGILE+D VLTVSP+YA+E +SG   G ELDNI
Sbjct:  160 DRVFIDHPLFLERVWGKTEEKIYGPDAGTDYKDNQLRFSLLCQAALEAPRILSLNNNPYFSGPYGEDVVFVCNDWHTGPLSCYLKSNYQSNGIYKDAKTAFCIHNISYQGRFAFSDFPELNLPERFKSSFDFIDGYEKPVEGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNI 341          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.235e-77
Identity = 133/182 (73.08%), Postives = 151/182 (82.97%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR FVDHP FL +VWGKT+ KIYGP  G DY+DNQLRF +LCQAALEAPRIL+LN+N YFSGPYGEDVVFV NDWHT  + CYLK+ Y+  G+Y+ AK  FCIHNI+YQGRFAF D+  LNLP +FKSSFDFIDGY KPV GRKINWMKAGILE+D VLTVSP+YA+E +SG   G ELDNI
Sbjct:  155 DRVFVDHPLFLERVWGKTEEKIYGPVAGTDYRDNQLRFSLLCQAALEAPRILSLNNNPYFSGPYGEDVVFVCNDWHTGPLSCYLKSNYQSHGIYRDAKTAFCIHNISYQGRFAFSDYPELNLPERFKSSFDFIDGYEKPVEGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNI 336          
BLAST of FC868546 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 5.531e-77
Identity = 131/182 (71.98%), Postives = 153/182 (84.07%), Query Frame = 1
Query:    7 DREFVDHPRFLAKVWGKTQSKIYGPRTGEDYQDNQLRFIVLCQAALEAPRILNLNSNKYFSGPYGEDVVFVANDWHTSLIPCYLKAMYKPKGMYKSAKVVFCIHNIAYQGRFAFEDFGLLNLPAQFKSSFDFIDGYNKPVRGRKINWMKAGILESDMVLTVSPHYAQETVSGEDXGVELDNI 552
            DR FVDHP FL KVWGKT SK+YGP TG D++DNQLRF +LC AALEAPR+LNLN+++YFSGPYGE+VVFVANDWHT+++PCYLK+MYK  G+Y++AKV FCIHNIAYQGRF   DF LLNLP  F  SFDF+DG+ KPV GRKINWMKAGI E D+VLTVSPHY +E  SG + GVELD +
Sbjct:  116 DRVFVDHPMFLEKVWGKTGSKLYGPTTGTDFRDNQLRFCLLCLAALEAPRVLNLNNSEYFSGPYGENVVFVANDWHTAVLPCYLKSMYKQNGIYENAKVAFCIHNIAYQGRFPRADFELLNLPESFMPSFDFVDGHVKPVVGRKINWMKAGITECDVVLTVSPHYVKELTSGPEKGVELDGV 297          
The following BLAST results are available for this feature:
BLAST of FC868546 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 135
Match NameE-valueIdentityDescription
SSG1_PEA1.715e-8679.67Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ANTMA4.672e-8479.67Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MANES7.969e-8479.56Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ARATH2.834e-8178.77Probable granule-bound starch synthase 1, chloropl... [more]
SSG1_SOLTU4.834e-8175.27Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_IPOBA8.246e-8175.69Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_HORVU2.933e-7873.63Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SORBI6.534e-7873.63Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MAIZE4.235e-7773.08Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1B_HORVU5.531e-7771.98Granule-bound starch synthase 1b, chloroplastic/am... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001G05EF AbioticL1 Citrus clementina cDNA clone C31001G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868546 ID=FC868546|Name=FC868546|organism=Citrus clementina|type=EST|length=552bp
TCCCGGGATCGGGAGTTTGTGGATCATCCTCGGTTTCTTGCGAAGGTGTG
GGGTAAAACCCAATCCAAAATCTATGGGCCTAGGACTGGAGAGGACTACC
AGGACAACCAACTTCGCTTCATTGTGTTGTGCCAGGCAGCTCTTGAAGCA
CCGAGAATTCTGAATCTTAACAGCAACAAATATTTCTCTGGACCATATGG
AGAAGATGTCGTTTTTGTTGCTAATGACTGGCATACTTCCCTTATCCCTT
GTTACCTGAAAGCTATGTATAAGCCCAAAGGGATGTACAAAAGTGCCAAA
GTTGTTTTTTGTATCCACAATATTGCTTACCAAGGAAGATTTGCATTTGA
GGATTTTGGACTTCTCAACCTTCCAGCTCAATTCAAAAGCTCTTTTGACT
TTATTGATGGATACAATAAACCTGTGAGAGGAAGAAAAATCAACTGGATG
AAAGCTGGAATATTAGAATCAGACATGGTCTTAACTGTGAGCCCACACTA
TGCCCAAGAAACTGTTTCTGGTGAAGACNAAGGAGTAGAATTGGATAACA
TC
back to top