FC868551

Overview
NameFC868551
Unique NameFC868551
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length596
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX4_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 7.668e-70
Identity = 124/178 (69.66%), Postives = 147/178 (82.58%), Query Frame = 2
Query:   65 DEVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAP-LLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCRFHTYETCEKLIVEAEC 595
            +EV+LLDFWP MFG+R+RIALA K + YEY+EEDL+NKSPLLLQMNP+HKKIP LIHNG+P+CES I V+YI+EV KDKAP LLPSDPY RAQARFW D ID K+YD  RK WTT+GEEQEAAKK+  E LK LEG LGDKP+FGG++FG+VD++LI +Y  F+ YET      EAEC
Sbjct:    4 EEVILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPNLLPSDPYDRAQARFWADYIDKKLYDFGRKLWTTKGEEQEAAKKDFIECLKVLEGALGDKPYFGGESFGFVDIALIGYYSWFYAYETFGNFSTEAEC 181          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTXC_TOBAC (Probable glutathione S-transferase parC OS=Nicotiana tabacum GN=PARC PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 6.491e-69
Identity = 122/178 (68.54%), Postives = 146/178 (82.02%), Query Frame = 2
Query:   65 DEVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAP-LLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCRFHTYETCEKLIVEAEC 595
            +EV+LLDFWP MFG+R+RIALA K + YEY++EDL+NKSPLLLQMNP+HKKIP LIHNG+P+CES I V+YI+EV KDKAP LLPSDPY RAQARFW D ID K+YD  RK W T+GEEQEAAKK+  E LK LEG LGD+P+FGG++FG+VD++LI FY  F+ YET      EAEC
Sbjct:    4 EEVILLDFWPSMFGMRLRIALAEKEIKYEYKQEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKGEEQEAAKKDFIECLKVLEGALGDRPYFGGESFGFVDIALIGFYSWFYAYETFGNFSTEAEC 181          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTXA_TOBAC (Probable glutathione S-transferase parA OS=Nicotiana tabacum GN=PARA PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.267e-64
Identity = 112/178 (62.92%), Postives = 144/178 (80.90%), Query Frame = 2
Query:   62 ADEVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCRFHTYETCEKLIVEAEC 595
            ++ VVLLDFWP  FG+R+RIALA KG+ YE +EE+L +KSPLLL+MNPVHKKIP LIHN + +CES  I++YIDEV  DK PLLPSDPY+R+QARFW D ID K+Y + R+ W+ +GE+QE AKKE  E+LKTLEG+LG+K +FGGDN G+VD++L+PF   F++YETC    +EAEC
Sbjct:    3 SNNVVLLDFWPSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILIHNSKAICESLNILEYIDEVWHDKCPLLPSDPYERSQARFWADYIDKKIYSTGRRVWSGKGEDQEEAKKEFIEILKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEAEC 180          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX3_SOYBN (Glutathione S-transferase 3 OS=Glycine max GN=GST3 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.161e-64
Identity = 117/179 (65.36%), Postives = 140/179 (78.21%), Query Frame = 2
Query:   59 MADEVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCRFHTYETCEKLIVEAEC 595
            M+DEVVLLD W  M+G+R RIALA KGV YEY+EE+L N+SPLLLQMNP+HKKIP LIHNG+P+CES IIVQYIDEV  DK+PL+PSDPY+R+QARFWVD ID K+YD+ +K W ++GEE E  KKEL  + K LE  L DKPF+G D FG+VDL LI F   F+TYET     +E EC
Sbjct:    1 MSDEVVLLDTWASMYGMRARIALAEKGVRYEYKEENLMNRSPLLLQMNPIHKKIPVLIHNGKPICESAIIVQYIDEVWNDKSPLMPSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEHEEGKKELISIFKQLEETLTDKPFYGDDTFGFVDLCLITFSSWFYTYETYGNFKMEEEC 179          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX1_NICPL (Probable glutathione S-transferase MSR-1 OS=Nicotiana plumbaginifolia GN=MSR-1 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.022e-62
Identity = 110/178 (61.80%), Postives = 143/178 (80.34%), Query Frame = 2
Query:   62 ADEVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCRFHTYETCEKLIVEAEC 595
            ++ VVLLDF    FG+R+RIALA KG+ YE +EE+L +KSPLLL+MNPVHKKIP LIHNG+P+CES  I++YIDEV  +K PLLPSDPYQR+QARFW + ID K+Y + R+ W+ +GE+QE AKKE  E+ KTLEG+LG+K +FGGDN G+VD++L+PF   F++YETC    +EAEC
Sbjct:    3 SNNVVLLDFSGSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILIHNGKPICESLNILEYIDEVWHEKCPLLPSDPYQRSQARFWANYIDNKIYSTGRRVWSGKGEDQEEAKKEFIEIFKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEAEC 180          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTU1_ORYSJ (Probable glutathione S-transferase GSTU1 OS=Oryza sativa subsp. japonica GN=GSTU1 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.247e-45
Identity = 93/183 (50.82%), Postives = 121/183 (66.12%), Query Frame = 2
Query:   68 EVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLP-------SDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFF---GGDNFGYVDLSLIPFYCRFHTYETCEKLIVE 586
            E+VLLDFW   FG R RIA+A KG+ +EY+EEDL NKS LLL+ NPVH+KIP L+H GRPV ES +I+QY+D+       LLP          Y RA ARFW D +D K+YD   + W  +GE Q AA +E+ E+L+TLE +LGD+ FF   GG   G+VD++L+PF   F++YE C    VE
Sbjct:    6 ELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGTPHLLPPANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAELGDREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVE 188          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTU1_ORYSI (Probable glutathione S-transferase GSTU1 OS=Oryza sativa subsp. indica GN=GSTU1 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.456e-44
Identity = 93/183 (50.82%), Postives = 123/183 (67.21%), Query Frame = 2
Query:   68 EVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLL-PSD------PYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFF---GGDNFGYVDLSLIPFYCRFHTYETCEKLIVE 586
            E+VLLDFW   FG R RIA+A KG+ +EY+EEDL NKS LLL+ NPVH+KIP L+H GRPV ES +I+QY+D+       LL P++       Y RA ARFW D +D K+YD   + W  +GE Q AA +E+ E+L+TLE +LGD+ FF   GG   G+VD++L+PF   F++YE C    VE
Sbjct:    6 ELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGTPHLLSPANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAELGDREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVE 188          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX2_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.724e-37
Identity = 81/153 (52.94%), Postives = 105/153 (68.63%), Query Frame = 2
Query:   68 EVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLS 526
            EV LL FW   F  R+  AL  KGV YEY EED  NKS LLLQ NPV+KK+P LIHNG+P+ ES II++YIDE  +  + +LP DPY RA ARFW   +D K+  +   T+  +GEEQE  K+E++E+LK L+ +L DK FF GD FG+ D++
Sbjct:    3 EVKLLGFWYSPFSHRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPVYKKVPVLIHNGKPIVESMIILEYIDETFEGPS-ILPKDPYDRALARFWAKFLDDKV-AAVVNTFFRKGEEQEKGKEEVYEMLKVLDNELKDKKFFAGDKFGFADIA 153          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX1_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.118e-36
Identity = 82/160 (51.25%), Postives = 108/160 (67.50%), Query Frame = 2
Query:   68 EVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDL--SLIPFY 541
            EV LL FW   F  R+  AL  KGV YEY EED  NKS LLLQ NP+HKK+P LIHNG+ + ES +I++YIDE  +  + +LP DPY RA ARFW   +D K+  +  KT+  +GEEQE  K+E+ E+LK L+ +L DK FF GD FG+ D+  +L+ F+
Sbjct:    3 EVKLLGFWYSPFSRRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPIHKKVPVLIHNGKRIVESMVILEYIDETFEGPS-ILPKDPYDRALARFWAKFLDDKV-PAVVKTFLRKGEEQEKDKEEVCEMLKVLDNELKDKKFFVGDKFGFADIAANLVAFW 160          
BLAST of FC868551 vs. ExPASy Swiss-Prot
Match: GSTX3_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.906e-36
Identity = 80/153 (52.29%), Postives = 104/153 (67.97%), Query Frame = 2
Query:   68 EVVLLDFWPIMFGIRIRIALAGKGV*YEYQEEDLKNKSPLLLQMNPVHKKIPALIHNGRPVCESPIIVQYIDEVRKDKAPLLPSDPYQRAQARFWVDLID*KMYDSSRKTWTTEGEEQEAAKKELFEVLKTLEGQLGDKPFFGGDNFGYVDLS 526
            EV LL FW   F  R+  AL  KGV YEY EED  NKS LLLQ NPVHKK+P LIHNG+P+ ES +I++YIDE  +  + +LP DPY RA ARFW   +  K+  +   T+  +GEEQE  K+E++E+LK L+ +L DK FF GD FG+ D++
Sbjct:    3 EVKLLGFWYSPFTHRVEWALKLKGVKYEYIEEDRDNKSSLLLQSNPVHKKVPVLIHNGKPIVESMVILEYIDETFEGPS-ILPKDPYDRALARFWSKFLGDKV-AAVVNTFFRKGEEQEKGKEEVYEMLKVLDNELKDKKFFVGDKFGFADIA 153          
The following BLAST results are available for this feature:
BLAST of FC868551 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
GSTX4_TOBAC7.668e-7069.66Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTXC_TOBAC6.491e-6968.54Probable glutathione S-transferase parC OS=Nicotia... [more]
GSTXA_TOBAC1.267e-6462.92Probable glutathione S-transferase parA OS=Nicotia... [more]
GSTX3_SOYBN2.161e-6465.36Glutathione S-transferase 3 OS=Glycine max GN=GST3... [more]
GSTX1_NICPL2.022e-6261.80Probable glutathione S-transferase MSR-1 OS=Nicoti... [more]
GSTU1_ORYSJ2.247e-4550.82Probable glutathione S-transferase GSTU1 OS=Oryza ... [more]
GSTU1_ORYSI1.456e-4450.82Probable glutathione S-transferase GSTU1 OS=Oryza ... [more]
GSTX2_TOBAC1.724e-3752.94Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX1_TOBAC1.118e-3651.25Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX3_TOBAC1.906e-3652.29Probable glutathione S-transferase OS=Nicotiana ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001G10EF AbioticL1 Citrus clementina cDNA clone C31001G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868551 ID=FC868551; Name=FC868551; organism=Citrus clementina; type=EST; length=596bp
GGAGTTTGTCTTGTCTTTTCATTCATTCACTCTTGACTCTTAGTAAGCTT
CTGTCACAATGGCGGACGAAGTGGTTCTGTTGGATTTCTGGCCCATCATG
TTTGGGATAAGGATCAGGATTGCTCTGGCGGGGAAAGGCGTCTAGTATGA
GTACCAGGAAGAGGACTTGAAGAACAAGAGCCCCCTGCTTCTGCAGATGA
ACCCCGTTCACAAGAAGATCCCGGCTCTCATCCACAACGGCAGACCGGTC
TGTGAGTCACCCATCATTGTTCAGTACATTGATGAAGTGCGGAAGGACAA
GGCTCCATTGCTTCCCTCTGATCCCTACCAGAGAGCTCAAGCTAGGTTCT
GGGTAGATCTCATTGACTAGAAGATGTACGATTCTTCGAGGAAGACATGG
ACCACAGAGGGAGAAGAGCAGGAGGCAGCTAAGAAGGAGCTCTTTGAAGT
TCTGAAGACTTTGGAAGGGCAGCTTGGAGACAAGCCTTTCTTTGGAGGAG
ACAATTTTGGGTATGTGGATTTAAGTCTGATCCCATTCTATTGTCGGTTT
CACACGTATGAGACATGTGAAAAGCTCATCGTCGAGGCTGAATGCC
back to top