FC868553

Overview
NameFC868553
Unique NameFC868553
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15109 contig Ccv1_Contig15109:5..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.270e-82
Identity = 153/191 (80.10%), Postives = 170/191 (89.01%), Query Frame = 2
Query:   74 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNRQ 646
            MA KSKILFIGGTGYIGKFIVEASAKAGH TFVLVRESTLS+P+K++L+D FK  GV  V GD+ +HESLVKAIKQVDVVISTVGH LL DQVK+IAAIKEAGN+KRFFPSEFGNDVDRVHAVEPAK+AF TKA+IRR VEAEGIP+TYVA+ FFA Y LPNL+QPGA  PP DKVVILG GN KAV+N++
Sbjct:    1 MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRVHAVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKE 191          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.902e-70
Identity = 132/192 (68.75%), Postives = 152/192 (79.17%), Query Frame = 2
Query:   71 VMASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNRQ 646
            V++ KSKIL IGGTGYIGK++VE SAK+GHPTF L+RESTL +P KS+L+D FK  GV L+ GD+ N ESL+KAIKQVDVVISTVG     DQV II AIKEAGNIKRF PSEFG DVD   A+EPA S FA K +IRR +EAEGIPYTYV  N+FA +FLPNL Q  A  PPRDKVVI GDGNPKA+Y ++
Sbjct:    2 VVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFLPSEFGFDVDHARAIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRDKVVIFGDGNPKAIYVKE 193          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 7.991e-69
Identity = 134/190 (70.53%), Postives = 152/190 (80.00%), Query Frame = 2
Query:   83 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQ--PGATAPPRDKVVILGDGNPKAVYNRQ 646
            KSKIL IGGTGYIGKF+VEASAKAGH TF LVRE+TLSDP K + +  FK LGV ++ GD+ +HESLVKAIKQVDVVISTVG   + DQ KII+AIKEAGN+KRF PSEFG DVDR  AVEPAKSAFA K +IRR +EAEGIPYTY  +  F  Y+LP L Q  PG T+PPRDKV ILGDGN KAV N++
Sbjct:    5 KSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDRTSAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKE 194          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.042e-56
Identity = 114/199 (57.29%), Postives = 145/199 (72.86%), Query Frame = 2
Query:   74 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRES----------TLSDP-SKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVY 637
            MA+++KIL +G TG IG+ IV AS KAG+PT+ LVR++          T ++P +K +L+D+++ LGV L+ GD+ +HE+LVKAIKQVD+VI   G  L+ DQVKII AIKEAGN+K+FFPSEFG DVDR  AVEP +  F  KA IRR +EAEG+PYTY+  + F  YFL NL+Q   T PPRDKVVILGDGN K  Y
Sbjct:    1 MATENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDRHEAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRDKVVILGDGNVKGAY 199          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.850e-55
Identity = 114/199 (57.29%), Postives = 140/199 (70.35%), Query Frame = 2
Query:   74 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRES-----------TLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVY 637
            MAS+++IL +G TG IG+ +V AS KAG+PT+ L+R++             +  SK +LL  FK  GV L+ GD+ +HE+LVKAIKQVD VI T G  L+ DQVKII AIKEAGN+KRFFPSEFG DVDR  AV+P +  F  KA IRR VEAEG+PYTY+  + F  YFL NL+Q  AT PPRDKV+ILGDGN K  Y
Sbjct:    1 MASQNRILVLGPTGAIGRHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVKRFFPSEFGLDVDRHDAVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRDKVIILGDGNVKGAY 199          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.257e-54
Identity = 105/187 (56.15%), Postives = 132/187 (70.59%), Query Frame = 2
Query:   77 ASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVY 637
            + KSKIL +GGTGY+G+ +V ASA+ GHPT  LVR++  SDP+K+ LL  F+  GV L+ GD+ +  SLV A+K  DVVIS +G   + DQ +++ AIKEAGN+KRFFPSEFG DVDR   VEPAKS    K  IRRA EA GIPYTY  + FFA + LP + Q  A  PP DK V+LGDG+ KAV+
Sbjct:    3 SEKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVKRFFPSEFGLDVDRTGIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPADKAVVLGDGDTKAVF 189          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.560e-54
Identity = 110/199 (55.28%), Postives = 140/199 (70.35%), Query Frame = 2
Query:   74 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVREST-----------LSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVY 637
            MA+++KIL +G TG IG+ IV AS KAG+PT+ LVR+++            +  +K +LL +++  GV L+ GD+ +HE+LV AIKQVD VI   G  L+ DQVK+I AIKEAGN+KRFFPSEFG DVDR  AVEP +  F  KA IRR VE+EG+PYTY+  + F  YFL NL+Q  AT PPRDKVVILGDGN +  Y
Sbjct:    1 MATENKILILGATGAIGRHIVWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVKRFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRDKVVILGDGNVRGAY 199          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 3.994e-44
Identity = 98/192 (51.04%), Postives = 126/192 (65.62%), Query Frame = 2
Query:   83 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVG------HTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRV-HAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVY 637
            KSK+L +GGTGY+G+ IV+AS + GH TF+L R     D  K Q+L  FKK G  LV     +H+SLV A+K VDVVI T+       H LL  Q+K++ AIK+AGNIKRF PSEFG D   + HA+EP +  F  K  +R+A+E   IP+TY+++N FA YF  NLSQ     PPRDKV++ GDGN K VY
Sbjct:    3 KSKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLL-TQLKLVEAIKDAGNIKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRDKVLLYGDGNVKPVY 193          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.738e-42
Identity = 92/187 (49.20%), Postives = 122/187 (65.24%), Query Frame = 2
Query:   83 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRE-STLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYN 640
            K KIL +G TGY+GK++V+AS   GHPT+  V      SD SK QLL  F+ LGV +  G++  H+ LV   K+VD+VIST+      +Q+K+I AIKEAGNIKRF PSEFGN+VDRV A+   ++    K KIRRA EA GIP+T+V++N   AYF+  L  P   +   ++V I G G+ KAV N
Sbjct:    5 KGKILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVDRVRALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKS---EQVTIYGSGDAKAVLN 188          
BLAST of FC868553 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.164e-41
Identity = 89/186 (47.85%), Postives = 122/186 (65.59%), Query Frame = 2
Query:   83 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYN 640
            KSKIL  GGTGYIG  +V+ S K GHPT+V  R ++    SK+ LLD F+ LG  +V G++  HE LV+ +K+VDVVIS +    + DQ KI+ AIK AGNIKRF PS+FG + DR++A+ P ++    K  IRRA+E   IPYTYV++N FA+YF+  L +P     P+D++ + G G  K   N
Sbjct:    7 KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNS----SKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRP---YDPKDEITVYGTGEAKFAMN 185          
The following BLAST results are available for this feature:
BLAST of FC868553 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU1.270e-8280.10Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_TOBAC1.902e-7068.75Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFRH_ARATH7.991e-6970.53Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFR_MEDSA2.042e-5657.29Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_CICAR3.850e-5557.29Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFRH_MAIZE4.257e-5456.15Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFR_PEA5.560e-5455.28Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_LUPAL3.994e-4451.04Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY3.738e-4249.20Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA3.164e-4147.85Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001G12EF AbioticL1 Citrus clementina cDNA clone C31001G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868553 ID=FC868553|Name=FC868553|organism=Citrus clementina|type=EST|length=665bp
ATTTGATCATTTCAAATCCAACAGAAAAAAAAAAGGAAAGAATCCCCGAA
ATTGAACTGAATAATTCTCGGTAATGGCGTCGAAAAGCAAGATTCTATTC
ATCGGCGGTACAGGGTACATCGGCAAATTCATCGTCGAAGCGAGCGCGAA
AGCCGGCCACCCGACGTTCGTGCTCGTGAGAGAATCCACACTCTCCGATC
CTTCCAAATCTCAGCTCCTCGATCACTTCAAAAAACTCGGCGTCAATCTC
GTCATCGGAGATGTGTTGAATCACGAGAGCTTGGTGAAGGCGATAAAACA
AGTGGACGTGGTGATATCAACGGTCGGTCACACTTTATTAGGTGATCAGG
TCAAGATTATTGCGGCCATTAAAGAAGCTGGTAACATTAAGAGATTCTTC
CCTTCAGAATTTGGGAATGATGTTGATCGAGTCCATGCCGTTGAGCCAGC
AAAATCAGCATTTGCCACAAAGGCAAAAATCCGCCGAGCCGTTGAGGCTG
AAGGGATTCCGTATACTTATGTAGCGTCGAATTTCTTTGCTGCTTACTTC
CTTCCCAATTTGTCGCAGCCCGGGGCCACTGCCCCACCTAGGGATAAAGT
TGTCATCTTAGGCGATGGCAATCCAAAAGCTGTTTATAACAGGCAGATGA
TATTGGTACCTATAC
back to top