FC868556

Overview
NameFC868556
Unique NameFC868556
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868556 vs. ExPASy Swiss-Prot
Match: WRK40_ARATH (Probable WRKY transcription factor 40 OS=Arabidopsis thaliana GN=WRKY40 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.124e-28
Identity = 68/144 (47.22%), Postives = 92/144 (63.89%), Query Frame = 1
Query:  271 TGILVEELNRISTENKKLNEMLSILCKNYNNLRQQYMDLMNKNT---ENEVGISKKRKAESEDH---CHTIGFNVHAXXXXXXXXXXXCKRPKDNNTKAKVSRFYVRASDSKFTLIVKDGYQWRKYGQKVTKRHPSPRAYFQCS 684
            T  LVEELNR+S ENKKL+EML+++C NYN LR+Q M+ +NK+     +++   KKRK+ + +    C  IG  V              K+ ++   K KVSR Y +   S  TL+VKDGYQWRKYGQKVT+ +PSPRAYF+C+
Sbjct:   30 TSALVEELNRVSAENKKLSEMLTLMCDNYNVLRKQLMEYVNKSNITERDQISPPKKRKSPAREDAFSCAVIG-GVSESSSTDQDEYLCKKQREETVVKEKVSRVYYKTEASDTTLVVKDGYQWRKYGQKVTRDNPSPRAYFKCA 172          
BLAST of FC868556 vs. ExPASy Swiss-Prot
Match: WRK18_ARATH (WRKY transcription factor 18 OS=Arabidopsis thaliana GN=WRKY18 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 5.404e-23
Identity = 68/190 (35.79%), Postives = 100/190 (52.63%), Query Frame = 1
Query:  193 SSEVPKREFKGDHFAEFEERASVKQETGI-LVEELNRISTENKKLNEMLSILCKNYNNLRQQYMDLMNKNT----ENEVGISKKRK--------------------AESEDHCHTIGFNVHAXXXXXXXXXXXCKRP-KDNNTKAKVSRFYVRASDSKFTLIVKDGYQWRKYGQKVTKRHPSPRAYFQCS 684
            S+++PK+E         + +   + E+   L EELNR+++ENKKL EML+ +C++YN L      L ++ +    + ++ I K+++                    + +EDH H      H            CKRP  D+  KAKVS  YV    S  +L VKDG+QWRKYGQKVT+ +PSPRAYF+CS
Sbjct:   19 SAKLPKKEVSVLASTHLKRKWLEQDESASELREELNRVNSENKKLTEMLARVCESYNELHNHLEKLQSRQSPEIEQTDIPIKKRKQDPDEFLGFPIGLSSGKTENSSSNEDHHH------HHQQHEQKNQLLSCKRPVTDSFNKAKVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCS 202          
BLAST of FC868556 vs. ExPASy Swiss-Prot
Match: WRK60_ARATH (Probable WRKY transcription factor 60 OS=Arabidopsis thaliana GN=WRKY60 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.575e-22
Identity = 66/173 (38.15%), Postives = 96/173 (55.49%), Query Frame = 1
Query:  193 SSEVPKREFKGDHFAEFEERASVKQET-GILVEELNRISTENKKLNEMLSILCKNYNNLRQQYMDLMNKNTENEVG-----ISKKRKAESEDHCHT-IGFNVHAXXXXXXXXXXXCKRPKDN--NTKAKVSRFYVRASDSKFTLIVKDGYQWRKYGQKVTKRHPSPRAYFQCS 684
            S ++PKRE         E++  VK E   +L +E+NR+++ENKKL EML+ +C+ Y  L     +L ++ +   V      ++ KRK E ++   + IG ++                P +N  N KA VS  Y  A  S  +L VKDGYQWRKYGQK+T+ +PSPRAYF+CS
Sbjct:   15 SGKLPKREVSASASKVVEKKWLVKDEKRNMLQDEINRVNSENKKLTEMLARVCEKYYALNNLMEELQSRKSPESVNFQNKQLTGKRKQELDEFVSSPIGLSLG---------------PIENITNDKATVSTAYFAAEKSDTSLTVKDGYQWRKYGQKITRDNPSPRAYFRCS 172          
The following BLAST results are available for this feature:
BLAST of FC868556 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
WRK40_ARATH1.124e-2847.22Probable WRKY transcription factor 40 OS=Arabidops... [more]
WRK18_ARATH5.404e-2335.79WRKY transcription factor 18 OS=Arabidopsis thalia... [more]
WRK60_ARATH4.575e-2238.15Probable WRKY transcription factor 60 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31001H03EF AbioticL1 Citrus clementina cDNA clone C31001H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868556 ID=FC868556; Name=FC868556; organism=Citrus clementina; type=EST; length=685bp
GATCATTCACTTGACTAACCTTATATTCTCAATTTTTTAACAAGCTATAG
GCCTATAGCTCTCTGGTCATTTGATCAGATTTGCTCGCATATATTTTCTT
TTTCAAGTTCTTGTGTTAGTTCTACAATTTGGTCAATGGATTCAACGTGG
GTGGACACCTCTCTTGACCTCAATCTCAATCTTCTGAATCACAGTAGTGA
AGTTCCGAAGAGAGAGTTTAAGGGAGATCACTTTGCTGAATTTGAAGAGA
GAGCTTCAGTTAAACAAGAGACTGGAATTTTGGTGGAGGAATTGAATAGG
ATAAGCACTGAGAACAAGAAGCTGAATGAAATGCTTTCCATTTTGTGTAA
GAATTACAACAATTTGCGGCAGCAGTACATGGATTTGATGAACAAGAACA
CAGAAAATGAAGTTGGAATATCAAAGAAGAGGAAGGCTGAGAGTGAAGAT
CATTGCCACACGATTGGCTTCAATGTACACGCTACTGAGTCCAGCACTAG
TACTGACGAAGAGTCATGCAAAAGGCCAAAGGATAACAACACCAAGGCAA
AAGTTTCTAGGTTTTATGTGAGAGCCAGTGATTCAAAATTCACCCTGATT
GTGAAGGATGGGTATCAATGGAGAAAGTATGGCCAAAAGGTTACAAAGAG
ACACCCATCACCTAGGGCTTACTTTCAGTGTTCTT
back to top