FC868559

Overview
NameFC868559
Unique NameFC868559
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length679
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig596 contig Ccv1_Contig596:22..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL31_ARATH (60S ribosomal protein L3-1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=5)

HSP 1 Score: 344.354 bits (882), Expect = 3.371e-94
Identity = 165/212 (77.83%), Postives = 182/212 (85.85%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKFEHPRHGSLGFLPRKRA RHRGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVR+VEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSLNTVWAQHLSEEVRRRFYKNW             QY++++GKK IQAQLEK+KKYA+V+RVLAHTQIRKMKGLKQKKAH+MEIQ+NGGTIA+KVD+AY FF KQIP++A F
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQIPIEAVF 212          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_ORYSJ (60S ribosomal protein L3 OS=Oryza sativa subsp. japonica GN=RPL3 PE=2 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 7.510e-94
Identity = 165/212 (77.83%), Postives = 181/212 (85.38%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKFEHPRHGSLGFLPRKR++RHRGKVK+FPKDD SKPC LT+F+GYKAGMTHIVR+VEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSLN+VWAQHLSEEVRRRFYKNWC            +Y++D GKK IQ QLEK+KKYAS+VRV+AHTQIRKMKGLKQKKAHLMEIQ+NGGTIA+KVDY Y FF K+IPVDA F
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAHLMEIQINGGTIADKVDYGYKFFEKEIPVDAVF 212          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL32_ARATH (60S ribosomal protein L3-2 OS=Arabidopsis thaliana GN=ARP2 PE=2 SV=4)

HSP 1 Score: 339.347 bits (869), Expect = 1.084e-92
Identity = 166/212 (78.30%), Postives = 179/212 (84.43%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKFEHPRHGSLGFLPRKRA+RHRGKVKAFPKDDP+KPCRLT+FLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSL TVWAQHLSEE+RRRFYKNW             ++ET+EGKK IQ+QLEK+KKY SV+RVLAHTQIRKMKGLKQKKAHL EIQ+NGG IA+KVDYA   F KQ+PVDA F
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGLRSLCTVWAQHLSEELRRRFYKNWAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMKGLKQKKAHLNEIQINGGDIAKKVDYACSLFEKQVPVDAIF 212          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3B_SCHPO (60S ribosomal protein L3-B OS=Schizosaccharomyces pombe GN=rpl3b PE=2 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 1.378e-71
Identity = 139/212 (65.57%), Postives = 160/212 (75.47%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSH KFE PRHGSLGFLPRKRA+R RGKVKAFPKDD SKP  LTAFLGYKAGMTHIVRD+++PGSK+HK+E  EAVTIIET          YV+TPRGLRSL TVWA+HLSEEV+RRFYKNW             +Y   E  +SI  +LE+IKKY SVVRVLAHTQIRK   L QKKAHLMEIQVNGG++A+KV++A   F K + + + F
Sbjct:    1 MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTIIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKYA--ESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTF 209          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_ASPFU (60S ribosomal protein L3 OS=Aspergillus fumigatus GN=rpl3 PE=1 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.800e-71
Identity = 135/212 (63.68%), Postives = 161/212 (75.94%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRK+E PRHGSL FLPRKRAARHRGKVK+FPKDDP KP  LTA +GYKAGMT +VRD+++PG+K+HKKE  EAVTIIET          Y++TPRGLRSL TVWA+HLS+EV+RRFYKNW             ++  + G  SI  +LE+IKKY +VVRVLAHTQIRK   LKQKKAHLMEIQVNGG++A+KVD+A   F K I +D+ F
Sbjct:    1 MSHRKYEAPRHGSLAFLPRKRAARHRGKVKSFPKDDPKKPVHLTASMGYKAGMTTVVRDLDRPGAKMHKKEIVEAVTIIETPPLVAVGVVGYIETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKHAEENG-ASITRELERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQVNGGSVADKVDFARNLFEKPIEIDSIF 210          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3A_SCHPO (60S ribosomal protein L3-A OS=Schizosaccharomyces pombe GN=rpl3a PE=1 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.800e-71
Identity = 138/212 (65.09%), Postives = 160/212 (75.47%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSH KFE PRHGSLGFLPRKRA+R RGKVKAFPKDD SKP  LTAFLGYKAGMTHIVRD+++PGSK+HK+E  EAVT+IET          YV+TPRGLRSL TVWA+HLSEEV+RRFYKNW             +Y   E  +SI  +LE+IKKY SVVRVLAHTQIRK   L QKKAHLMEIQVNGG++A+KV++A   F K + + + F
Sbjct:    1 MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTVIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKYA--ESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTF 209          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 262.307 bits (669), Expect = 1.685e-69
Identity = 126/212 (59.43%), Postives = 160/212 (75.47%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDDPSKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE  EAVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ D GKK ++     +KKY  V+R++AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A     +Q+PV+  F
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVF 211          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens GN=RPL3 PE=1 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 1.685e-69
Identity = 126/212 (59.43%), Postives = 161/212 (75.94%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDDPSKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE  EAVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ ++GKK ++     +KKY  V+RV+AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A     +Q+PV+  F
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVF 211          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_NEUCR (60S ribosomal protein L3 OS=Neurospora crassa GN=rpl-3 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.200e-69
Identity = 129/212 (60.85%), Postives = 160/212 (75.47%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRK+E PRHGSL +LPRKRAARHRGKVK+FPKDD  KP  LTA +GYKAGMT IVRD+++PG+K HKKE  EAVTII+T          Y++TPRGLRSL TVWA+HLS+EV+RRFYKNW             ++  + G  +I  +LE+IKKY +VVRVLAHTQIRK   LKQKKAHLMEIQ+NGG++A+KV++ +G F K + +D+ F
Sbjct:    1 MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTAAMGYKAGMTTIVRDLDRPGAKAHKKEVVEAVTIIDTPPMIVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYVKKHSDNNG-AAITRELERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQINGGSVADKVEFGHGLFEKPVSIDSIF 210          
BLAST of FC868559 vs. ExPASy Swiss-Prot
Match: RL3_TOXCA (60S ribosomal protein L3 OS=Toxocara canis GN=RPL3 PE=2 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 1.092e-68
Identity = 124/212 (58.49%), Postives = 157/212 (74.06%), Query Frame = 2
Query:   44 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFF*KQIPVDAXF 679
            MSHRKF  PRHGS+GF P+KR+ RHRGKVKAFPKDDP+KP  LTAF+ +KAGMTHIVR+V+KPGSK++KKE  EAVTI E           Y+ TPRG R   TVWA+HLSE+ R RFYKNW             +++ ++G+KSI+A L K+KKY S +RV+AHTQ++ MK  ++KKAH+MEIQ+NGGT+AEKVD+A     KQ+PVD+ F
Sbjct:    1 MSHRKFSAPRHGSMGFTPKKRSKRHRGKVKAFPKDDPTKPIHLTAFIAFKAGMTHIVREVDKPGSKVNKKEVVEAVTIFEAPPMVIVGIVGYIDTPRGPRQFKTVWAEHLSEDCRGRFYKNWHTSKKKAFQKHAKKWQDEDGRKSIEADLNKMKKYCSKIRVIAHTQMKVMKH-REKKAHIMEIQINGGTVAEKVDWAREHLEKQVPVDSVF 211          
The following BLAST results are available for this feature:
BLAST of FC868559 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
RL31_ARATH3.371e-9477.8360S ribosomal protein L3-1 OS=Arabidopsis thaliana... [more]
RL3_ORYSJ7.510e-9477.8360S ribosomal protein L3 OS=Oryza sativa subsp. ja... [more]
RL32_ARATH1.084e-9278.3060S ribosomal protein L3-2 OS=Arabidopsis thaliana... [more]
RL3B_SCHPO1.378e-7165.5760S ribosomal protein L3-B OS=Schizosaccharomyces ... [more]
RL3_ASPFU1.800e-7163.6860S ribosomal protein L3 OS=Aspergillus fumigatus ... [more]
RL3A_SCHPO1.800e-7165.0960S ribosomal protein L3-A OS=Schizosaccharomyces ... [more]
RL3_RAT1.685e-6959.4360S ribosomal protein L3 OS=Rattus norvegicus GN=R... [more]
RL3_HUMAN1.685e-6959.4360S ribosomal protein L3 OS=Homo sapiens GN=RPL3 P... [more]
RL3_NEUCR2.200e-6960.8560S ribosomal protein L3 OS=Neurospora crassa GN=r... [more]
RL3_TOXCA1.092e-6858.4960S ribosomal protein L3 OS=Toxocara canis GN=RPL3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31001H07EF AbioticL1 Citrus clementina cDNA clone C31001H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868559 ID=FC868559|Name=FC868559|organism=Citrus clementina|type=EST|length=679bp
GAGAGCACACGAGTCAGTCGCCGCAGCAGCTCAGAGGAGGAGAATGTCTC
ACAGGAAGTTTGAGCACCCAAGGCATGGTTCCCTTGGATTTCTTCCAAGG
AAGCGAGCTGCTCGTCACAGAGGAAAGGTGAAGGCTTTTCCCAAGGATGA
CCCAAGCAAGCCTTGCAGGCTCACTGCCTTTTTGGGTTACAAGGCTGGGA
TGACCCACATTGTTAGGGATGTCGAGAAACCTGGATCTAAGCTTCACAAG
AAGGAGACCTGTGAGGCTGTTACCATTATTGAAACCCCTCCAATGATGGT
GGTTGGAGTTGTGGGATATGTGAAGACACCTCGTGGTCTTCGCTCTTTGA
ACACTGTATGGGCTCAGCATCTTAGTGAGGAGGTGAGAAGAAGGTTCTAC
AAGAACTGGTGCAAATCCAAGAAGAAGGCTTTCACAAAATACTCAAAGCA
GTATGAAACAGATGAAGGGAAGAAAAGTATCCAAGCTCAGCTGGAGAAGA
TCAAGAAGTATGCATCTGTTGTTCGTGTTCTTGCTCACACTCAGATTAGG
AAAATGAAGGGTTTGAAGCAGAAGAAGGCACACCTGATGGAAATCCAGGT
CAATGGTGGCACCATTGCTGAAAAAGTTGACTATGCATATGGCTTCTTTT
GAAAGCAAATTCCTGTTGATGCTGNTTTC
back to top