FC868561

Overview
NameFC868561
Unique NameFC868561
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length681
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14112 contig Ccv1_Contig14112:4..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868561 vs. ExPASy Swiss-Prot
Match: USF_AQUPY (Protein usf OS=Aquifex pyrophilus GN=usf PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.370e-15
Identity = 55/173 (31.79%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  157 IQIQRDDTTFDAYVVG-KEDAPGIVVVQEWWGVDFEIKNHAVKISQL-NPGFKALIPDLYRGKVGLDTAEAQHLMSG-----LDWPGAVKDIHASVNWLKA---NGSKKVGVTGYCMGGALAIASSVLVPE-VDAVVSFYGVPPPELADPTQAKAPVQAHFGELDNFVGFSDV 642
            ++ +++      Y+   K   PG++V+ EWWG++  + N      +    GF A  PD Y GK   +  +A  LM+      +D   A+    ASV++LK       KKVGVTG+C GG L++  +   P+ +DA V FYG+P     D    K P+     E D FV   +V
Sbjct:    5 VEFEKNGVKVRGYIATPKWGGPGVIVIHEWWGLESPLSNIKEICDRFAQEGFVAFAPDFYEGKYADNPDDAGKLMTDMFENRMDKVDAI--FKASVDFLKECRYTSPKKVGVTGFCCGGTLSMYFAGKFPDLIDASVPFYGLPQITKIDAENIKVPIFFILAEKDEFVNNDEV 175          
BLAST of FC868561 vs. ExPASy Swiss-Prot
Match: DLHH_AQUAE (Putative carboxymethylenebutenolidase OS=Aquifex aeolicus GN=aq_1997 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.564e-13
Identity = 51/171 (29.82%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  157 IQIQRDDTTFDAYVVGKEDA-PGIVVVQEWWGVDFEIKNHAVKISQL-NPGFKALIPDLYRGKVGLDTAEAQHLMSGL---DWPGAVKDIHASVNWLKA---NGSKKVGVTGYCMGGALAIASSVLVPE-VDAVVSFYGVPPPELADPTQAKAPVQAHFGELDNFVGFSDV 642
            ++ +++      Y+   + A P ++V  EWWG++  + N      +L + GF A  PD Y+G+   +  +A  LM+ +         +   ASV ++K       KKVG+TG+C GG LA+  +   PE VDA + FYG+P     +    K P+     E D FV   +V
Sbjct:    5 VEFEKNGVKVRGYIATPKWAGPAVLVFHEWWGLESPLSNIKEICDKLADEGFVAFAPDFYKGQYADNPDDAGKLMTEMFEKRMDEVDRIFQASVEFVKECRYTYPKKVGITGFCCGGTLAMYFAAKFPEMVDASLPFYGLPQLTQINAENIKVPIFFILAEKDEFVNNDEV 175          
The following BLAST results are available for this feature:
BLAST of FC868561 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
USF_AQUPY5.370e-1531.79Protein usf OS=Aquifex pyrophilus GN=usf PE=4 SV=1[more]
DLHH_AQUAE6.564e-1329.82Putative carboxymethylenebutenolidase OS=Aquifex a... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31001H09EF AbioticL1 Citrus clementina cDNA clone C31001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868561 ID=FC868561|Name=FC868561|organism=Citrus clementina|type=EST|length=681bp
GGAGTCACTGAGTAGATAATGCTCGCAGCTGCTTCGAGAATCTTGAGCAG
ATCAACTCCGCTTCTTAAGCCCTCTCTCGCAAGGACTCACTTTCCCGCCG
GTTATCGCTTTGCAGTCAGATCAATGGCAGACTCTGCAGCTTCGCCCTTC
AAGAAAATCCAGATTCAGAGAGATGATACTACTTTTGATGCATATGTGGT
TGGCAAAGAAGACGCCCCTGGGATTGTTGTAGTTCAGGAGTGGTGGGGTG
TTGATTTTGAGATCAAGAACCATGCTGTCAAAATCTCCCAACTAAACCCT
GGATTCAAGGCACTTATACCAGATTTATATCGGGGAAAGGTTGGTTTGGA
TACTGCTGAAGCACAGCACTTGATGAGTGGTCTTGATTGGCCAGGTGCTG
TCAAGGATATCCACGCTTCAGTTAATTGGCTTAAGGCAAATGGTTCCAAG
AAGGTTGGCGTGACTGGATATTGCATGGGAGGTGCTCTCGCTATTGCAAG
TTCTGTCTTAGTTCCTGAGGTTGATGCTGTTGTTTCATTTTATGGGGTTC
CCCCACCTGAGCTCGCCGATCCTACCCAGGCTAAGGCACCTGTTCAAGCT
CATTTTGGGGAGCTTGACAATTTTGTTGGCTTTTCAGATGTGAAAACTGC
CAAAGCATTGGAGGAAAAAGCTGAAGCATCT
back to top