FC868639

Overview
NameFC868639
Unique NameFC868639
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868639 vs. ExPASy Swiss-Prot
Match: RK29_ARATH (50S ribosomal protein L29, chloroplastic OS=Arabidopsis thaliana GN=RPL29 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.945e-39
Identity = 93/159 (58.49%), Postives = 110/159 (69.18%), Query Frame = 1
Query:   85 MSLSIAS--TTTITFPTEPFSKIPKSTFNGIQIRQSWPIRTPLRFATXXXXXXXXXTVVMMAKREEEMKEIRAKTTEEINEEVVDLKGELFMLRLQKSVRNEFKSSEFXXXXXXXXXXLTVKRERELEEGINKRLSRKLDRQWKKSIVVRPPPSLKKLQ 555
            +SLSIA+  T  I       +    S+F+G++I+     R P   A          +VVMM+KRE E+KEIR+KTTE++ EEVVDLKGELFMLRLQKS RNEFKSS+F          LTVKRERE++EGI KRLSRKLDRQWKKSIV RPPPSLKKLQ
Sbjct:    2 LSLSIATPGTAAIFRRGTASATSTSSSFHGVRIQHQVSARVPA--AATISSSSPKPSVVMMSKREAELKEIRSKTTEQLQEEVVDLKGELFMLRLQKSARNEFKSSDFRRMKKQVARMLTVKREREIKEGIKKRLSRKLDRQWKKSIVPRPPPSLKKLQ 158          
BLAST of FC868639 vs. ExPASy Swiss-Prot
Match: RK29_MAIZE (50S ribosomal protein L29, chloroplastic OS=Zea mays GN=RPL29 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.083e-33
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 1
Query:   82 TMSLSIASTTTITFPTEPFSKIPKSTFNGIQIRQSWPIRTPLRFATXXXXXXXXXTVVMMAKREEEMKEIRAKTTEEINEEVVDLKGELFMLRLQKSVRNEFKSSEFXXXXXXXXXXLTVKRERELEEGINKRLSRKLDRQWKKSIVVRPPPSLK 546
            TMSL+ AS    + P    ++ P + F  I++  +   R                 +V MAKRE+E++EIRA TTE++ EEVVDLKGELF+LRL++S R EFK+SEF          LTVKRERE+E+GINKRLSRKLDR+WK+SIVVRPPPSL+
Sbjct:    3 TMSLAAASPLA-SIPRGIAAQAPCAAFLSIRLGGATATRFAGLAVASQPAERRAAAMVAMAKREQELEEIRAMTTEQMEEEVVDLKGELFLLRLKRSARQEFKNSEFSRMRKRIARMLTVKREREIEQGINKRLSRKLDRKWKQSIVVRPPPSLR 156          
The following BLAST results are available for this feature:
BLAST of FC868639 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RK29_ARATH1.945e-3958.4950S ribosomal protein L29, chloroplastic OS=Arabid... [more]
RK29_MAIZE2.083e-3351.6150S ribosomal protein L29, chloroplastic OS=Zea ma... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31002H11EF AbioticL1 Citrus clementina cDNA clone C31002H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868639 ID=FC868639; Name=FC868639; organism=Citrus clementina; type=EST; length=702bp
GGAGAGCTTACTCAAGTACGTTCTTAGCGCTGGTCACGAAGGCACATTGC
TCACTCAACGCAGCGAAGCAGCCAAAAGATGACGATGAGTCTCTCAATTG
CTTCGACAACAACAATCACTTTCCCAACAGAGCCCTTCTCGAAAATTCCA
AAGTCAACCTTTAACGGCATCCAAATTCGTCAGTCGTGGCCTATTCGCAC
GCCGTTGCGTTTCGCGACTTCGTCGTCGGGAAGCCGTGGTTCGTCGACAG
TGGTTATGATGGCAAAGAGAGAAGAAGAAATGAAGGAAATTAGAGCCAAA
ACGACAGAGGAGATTAACGAAGAGGTCGTTGATTTGAAGGGTGAGCTGTT
TATGCTACGTCTTCAAAAATCAGTTCGCAATGAGTTCAAGTCTAGTGAAT
TTCGTCGTATGCGCAGAAGGATTGCTCGCATGCTTACTGTTAAACGTGAA
AGAGAGCTTGAGGAAGGAATTAACAAGAGATTGTCCAGAAAGCTTGATCG
ACAATGGAAGAAAAGCATTGTAGTTAGACCACCTCCATCCTTGAAGAAGT
TGCAAGAGGAAGAGGCGGCTGCAGAAGCTGAGAAGTCTGCATGAGCCATC
TATATACACTTTGCAAATAATTTGTTTTCATTTTTTTAAGTGAAAGCTCC
TGAAATCATTGCAGAATTGCTGGCTCAAACAATTTGTGTGTATGTTCTCG
TA
back to top