FC868642

Overview
NameFC868642
Unique NameFC868642
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length778
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: HAL3A_ARATH (Phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3A PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 4.791e-66
Identity = 104/127 (81.89%), Postives = 118/127 (92.91%), Query Frame = 1
Query:  304 DREAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWDYNK 684
            DR+ M+VNT  RKPR+LLAASGSVAAIKFGNLCHCF+EWAEVRAV TKSSLHF+D+ +LP++V  YTDEDEW++WNKIGD VLHIELRRWAD++VIAPLSANTLGKIAGGLCDNLLTCI+RAWDY K
Sbjct:    7 DRQDMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTKSSLHFLDKLSLPQEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLCDNLLTCIIRAWDYTK 133          

HSP 2 Score: 35.4242 bits (80), Expect = 4.791e-66
Identity = 14/15 (93.33%), Postives = 14/15 (93.33%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNP 731
            LFVAPAMNT MWNNP
Sbjct:  135 LFVAPAMNTLMWNNP 149          

HSP 3 Score: 29.6462 bits (65), Expect = 4.791e-66
Identity = 12/15 (80.00%), Postives = 15/15 (100.00%), Query Frame = 2
Query:  734 TERHLMSIDELGISL 778
            TERHL+S+DELGI+L
Sbjct:  151 TERHLLSLDELGITL 165          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: HAL3B_ARATH (Probable phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3B PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.416e-61
Identity = 99/123 (80.49%), Postives = 115/123 (93.50%), Query Frame = 1
Query:  316 MQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWDYNK 684
            M+V+T  RKPRILLAASGSVA+IKF NLCHCFSEWAEV+AVA+KSSL+F+D+ +LP++V  YTDEDEW++WNKIGD VLHIELRRWAD+M+IAPLSANTL KIAGGLCDNLLTCIVRAWDY+K
Sbjct:    3 MEVDTVTRKPRILLAASGSVASIKFSNLCHCFSEWAEVKAVASKSSLNFVDKPSLPQNVTLYTDEDEWSSWNKIGDPVLHIELRRWADVMIIAPLSANTLAKIAGGLCDNLLTCIVRAWDYSK 125          

HSP 2 Score: 35.4242 bits (80), Expect = 1.416e-61
Identity = 14/15 (93.33%), Postives = 14/15 (93.33%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNP 731
            LFVAPAMNT MWNNP
Sbjct:  127 LFVAPAMNTLMWNNP 141          

HSP 3 Score: 26.9498 bits (58), Expect = 1.416e-61
Identity = 11/15 (73.33%), Postives = 14/15 (93.33%), Query Frame = 2
Query:  734 TERHLMSIDELGISL 778
            TERHL+ +DELGI+L
Sbjct:  143 TERHLVLLDELGITL 157          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: COAC_MOUSE (Phosphopantothenoylcysteine decarboxylase OS=Mus musculus GN=Ppcdc PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.436e-29
Identity = 61/118 (51.69%), Postives = 79/118 (66.95%), Query Frame = 1
Query:  337 RKPRILLAASGSVAAIKFGNLCHCFSE--WAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWDYNK 684
            RK R+L+  +GSVAA+K   L     +    EV  V T+ + HF     +P  V  Y+D DEW  W +  D VLHI+LRRWAD+M++APL ANTLGK+A G+CDNLLTC++RAWD NK
Sbjct:   16 RKFRVLVGVTGSVAALKLPLLVSKLLDVPGLEVTVVTTERAKHFYSPQDVP--VTLYSDADEWEMWKRRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLLTCVIRAWDLNK 131          

HSP 2 Score: 26.5646 bits (57), Expect = 1.436e-29
Identity = 11/30 (36.67%), Postives = 17/30 (56.67%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNPSQSGILCQLMSLEFL 776
            L   PAMNT MW +P  +  + QL +  ++
Sbjct:  133 LLFCPAMNTAMWEHPLTAQQVAQLKAFGYV 162          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: COAC_HUMAN (Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens GN=PPCDC PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.812e-27
Identity = 58/118 (49.15%), Postives = 77/118 (65.25%), Query Frame = 1
Query:  337 RKPRILLAASGSVAAIKFGNLCHCFSE--WAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWDYNK 684
            RK  +L+  +GSVAA+K   L     +    EV  V T+ + HF     +P  V  Y+D DEW  W    D VLHI+LRRWAD++++APL ANTLGK+A G+CDNLLTC++RAWD +K
Sbjct:   16 RKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIP--VTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSK 131          

HSP 2 Score: 25.409 bits (54), Expect = 2.812e-27
Identity = 11/30 (36.67%), Postives = 17/30 (56.67%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNPSQSGILCQLMSLEFL 776
            L   PAMNT MW +P  +  + QL +  ++
Sbjct:  133 LLFCPAMNTAMWEHPITAQQVDQLKAFGYV 162          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: TYSY_SCHPO (Probable thymidylate synthase OS=Schizosaccharomyces pombe GN=SPAC15E1.04 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.039e-22
Identity = 51/114 (44.74%), Postives = 74/114 (64.91%), Query Frame = 1
Query:  340 KPRILLAASGSVAAIKFGNLCHCFSEW--AEVRAVATKSSLHFIDRAALPK-DVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAW 672
            K  IL+AA+GSVAAIK   +      +   +V+ V T  + +F+++  L    V  Y + D+W  W+ +   + HIELRRWA +++IAPLSANT+ K+A GLCDNLLT ++RAW
Sbjct:   30 KYHILVAATGSVAAIKLTLIVKSLLTYKGVDVQVVLTDPARNFVEKEDLTALGVNVYNNADDWKNWDGLECPITHIELRRWAHLLLIAPLSANTMAKMANGLCDNLLTSLIRAW 143          

HSP 2 Score: 28.8758 bits (63), Expect = 1.039e-22
Identity = 10/15 (66.67%), Postives = 12/15 (80.00%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNP 731
            + +APAMNT MW NP
Sbjct:  149 ILLAPAMNTLMWTNP 163          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: COAC_DICDI (Putative phosphopantothenoylcysteine decarboxylase OS=Dictyostelium discoideum GN=ppcdc PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.973e-22
Identity = 50/116 (43.10%), Postives = 71/116 (61.21%), Query Frame = 1
Query:  340 KPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSLHFI---DRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWDY 678
            K  ++L  +GSVA IK   L     +   +  + T++SL F+   D   +      Y D+DEW   + +  S LHI+LR WA+ ++I+P SANTLGKI+ GLCDNLLT ++RAWDY
Sbjct:   12 KKNLILGLTGSVATIKAKLLVEQLIQHFNLIVIPTETSLKFLSDQDFEFISSKCKIYKDKDEWENVDLLKRSALHIDLRNWANSILISPCSANTLGKISNGLCDNLLTSLIRAWDY 127          

HSP 2 Score: 29.261 bits (64), Expect = 3.973e-22
Identity = 10/16 (62.50%), Postives = 13/16 (81.25%), Query Frame = 3
Query:  684 ALFVAPAMNTFMWNNP 731
            ++ +APAMNT MW NP
Sbjct:  131 SMILAPAMNTMMWENP 146          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: VHS3_YEAST (Protein VHS3 OS=Saccharomyces cerevisiae GN=VHS3 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.071e-20
Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  478 LPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWD 675
            LP  + F+TD+DEW  W +  D VLHIELRRWADI+V+APL+ANTL KIA GLCDNLLT ++RAW+
Sbjct:  434 LPAHIQFWTDQDEWDVWRQRTDPVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRAWN 499          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: SIS2_YEAST (Protein SIS2 OS=Saccharomyces cerevisiae GN=SIS2 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.317e-20
Identity = 43/66 (65.15%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  478 LPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWD 675
            LP  +  +TD+DEW  W +  D VLHIELRRWADI+V+APL+ANTL KIA GLCDNLLT ++RAW+
Sbjct:  353 LPPHIQLWTDQDEWDAWKQRTDPVLHIELRRWADILVVAPLTANTLSKIALGLCDNLLTSVIRAWN 418          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: SIS2_CANTR (Protein SIS2 OS=Candida tropicalis GN=SIS2 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.678e-19
Identity = 47/93 (50.54%), Postives = 63/93 (67.74%), Query Frame = 1
Query:  412 SEWAEVRAVATKSSLHFIDRAALP-----KDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAWD 675
            S+   ++ + TKSS +F+    L      K V  +TD DEW TW    D VLHIELRRWADI+++ PL+ANTL KI+ G+CDNLLT ++RAW+
Sbjct:  296 SDKISIQVILTKSSENFLLPETLNVLENVKKVRVWTDIDEWTTWKTRLDPVLHIELRRWADILLVCPLTANTLAKISLGICDNLLTNVIRAWN 388          
BLAST of FC868642 vs. ExPASy Swiss-Prot
Match: YKI8_YEAST (Uncharacterized protein YKL088W OS=Saccharomyces cerevisiae GN=YKL088W PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.949e-18
Identity = 56/157 (35.67%), Postives = 81/157 (51.59%), Query Frame = 1
Query:  277 MAYSEPTSTDREAMQVNTGLRKP-------------RILLAASGSVAAIK----FGNLCHCFS-EWAEVRAVATKSSLHFIDRAALPKDVIFYTDEDEWA--TWNKIGDS-----VLHIELRRWADIMVIAPLSANTLGKIAGGLCDNLLTCIVRAW 672
            ++ +  T  ++E +   TG R P              IL+ A+GSVA IK       L   +  E   ++ + TK + HF+    +   V  + +ED W     NK   S     +LH ELR+WADI +IAPLSANTL K+A G+C+NLLT ++R W
Sbjct:  274 LSANNSTHKNKEVITAPTGPRVPFTEFFQKEDDKKFHILIGATGSVATIKVPLIIDKLFKIYGPEKISIQLIVTKPAEHFLKGLKMSTHVKIWREEDAWVFDAVNKNDTSLSLNLILHHELRKWADIFLIAPLSANTLAKLANGICNNLLTSVMRDW 430          

HSP 2 Score: 27.335 bits (59), Expect = 2.949e-18
Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 3
Query:  687 LFVAPAMNTFMWNNPSQSGILCQLM 761
            + +APAMNTFM+ NP     L  L+
Sbjct:  436 VLIAPAMNTFMYINPMTKKHLTSLV 460          
The following BLAST results are available for this feature:
BLAST of FC868642 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
HAL3A_ARATH4.791e-6681.89Phosphopantothenoylcysteine decarboxylase OS=Arabi... [more]
HAL3B_ARATH1.416e-6180.49Probable phosphopantothenoylcysteine decarboxylase... [more]
COAC_MOUSE1.436e-2951.69Phosphopantothenoylcysteine decarboxylase OS=Mus m... [more]
COAC_HUMAN2.812e-2749.15Phosphopantothenoylcysteine decarboxylase OS=Homo ... [more]
TYSY_SCHPO1.039e-2244.74Probable thymidylate synthase OS=Schizosaccharomyc... [more]
COAC_DICDI3.973e-2243.10Putative phosphopantothenoylcysteine decarboxylase... [more]
VHS3_YEAST1.071e-2066.67Protein VHS3 OS=Saccharomyces cerevisiae GN=VHS3 P... [more]
SIS2_YEAST5.317e-2065.15Protein SIS2 OS=Saccharomyces cerevisiae GN=SIS2 P... [more]
SIS2_CANTR7.678e-1950.54Protein SIS2 OS=Candida tropicalis GN=SIS2 PE=3 SV... [more]
YKI8_YEAST2.949e-1835.67Uncharacterized protein YKL088W OS=Saccharomyces c... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003A02EF AbioticL1 Citrus clementina cDNA clone C31003A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868642 ID=FC868642; Name=FC868642; organism=Citrus clementina; type=EST; length=778bp
GGCGTCAGTTTATCCTTTTGCATGTTACTTCAAAATTTGATGGCGTTGCT
TTGTTTGTCAACGTCGCGGCTGCCGCTCTCTATTTAAAACCCCCCTCGCA
CTCTCTCTACTCTCTAGGTCTAGGCTGCCTCCAAGCCAGCGACCGTTAGT
CGTCGGTTTCCACACTCCGACGCTGCGACGTCGATTGTTGTCTCCCCTCC
GCCACGCCACTCGTGGATTGCTGTTCTACCACCGCCGGCCGCGGCTGATC
TGATTCATCTCATCTCATGATTGATTATGGCATACTCTGAACCTACAAGT
ACCGATAGGGAGGCGATGCAGGTCAATACTGGTCTGAGGAAACCCCGTAT
TTTACTTGCTGCAAGTGGAAGTGTAGCTGCAATAAAATTTGGGAATCTCT
GTCATTGTTTTTCTGAGTGGGCGGAAGTAAGAGCGGTGGCCACAAAGTCC
TCTCTACACTTCATTGATAGAGCAGCGCTTCCTAAGGATGTGATCTTTTA
CACAGACGAGGATGAATGGGCCACCTGGAACAAAATAGGTGATAGCGTTC
TTCACATCGAGCTCCGCAGATGGGCTGATATTATGGTTATTGCTCCGCTG
TCAGCAAACACACTTGGCAAGATTGCAGGTGGATTGTGTGACAATCTGCT
GACATGCATTGTGCGGGCATGGGACTACAATAAGCACTGTTTGTTGCACC
TGCTATGAACACTTTCATGTGGAATAATCCATCACAGAGCGGCATCTTAT
GTCAATTGATGAGCTTGGAATTTCTCTC
back to top