FC868648

Overview
NameFC868648
Unique NameFC868648
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868648 vs. ExPASy Swiss-Prot
Match: Y4920_ARATH (Uncharacterized protein At4g37920, chloroplastic OS=Arabidopsis thaliana GN=At4g37920 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 6.339e-22
Identity = 55/166 (33.13%), Postives = 95/166 (57.23%), Query Frame = 2
Query:  191 RLRKSSLAAVARDVSAVYHDSNEPASIREDSVMDGEKRDEKDGSKSLDDGKMIRVCDKLIEVFMVDKPTPTDWRRLLVFSKEWNNLRSNFFKRCQDRADAEVDPEMXXXXXXXXXXXXEIDEDVQRHNELLEVIKAAPSEVSQIVSRRRKDFTQEFFEHLHTVAES 688
            ++RKSS    A D   V ++    A ++  SV D  + +  +G        M + CDK+I++F+ +KP    W+  LV   EWN    NF+KRC+ RAD E DP +            +ID+++++HN+LL+ I+  P++++ I ++RR+DFT EFF ++  ++E+
Sbjct:   41 KIRKSSTITFATDT--VTYNGTTSAEVKS-SVEDPMEVEVAEGYT------MAQFCDKIIDLFLNEKPKVKQWKTYLVLRDEWNKYSVNFYKRCRIRADTETDPILKQKLVSLESKVKKIDKEMEKHNDLLKEIQENPTDINAIAAKRRRDFTGEFFRYVTLLSET 197          
The following BLAST results are available for this feature:
BLAST of FC868648 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4920_ARATH6.339e-2233.13Uncharacterized protein At4g37920, chloroplastic O... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003A08EF AbioticL1 Citrus clementina cDNA clone C31003A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868648 ID=FC868648; Name=FC868648; organism=Citrus clementina; type=EST; length=706bp
GACGAGCTTTCTGGTAAATGTTCAGCAGTGCTTTCTAATGGAGTTGGCGC
GTGTGGCTTCCCAAGGCTCTTGCTTTCTCCCTCTCATAAATTTTCGAGCT
CGGGCACCTGTCTCTTCCATCAGTAGCTCAGTTCCAATTTTATTTTCCTC
TCATAAATTTAAATGTTGTCCTTTGCTGGTTAATCCGGTGAGGCTGCGAA
AGTCCTCCCTCGCTGCTGTTGCTCGTGATGTAAGTGCCGTATATCATGAT
TCTAATGAGCCTGCTAGTATTCGTGAGGATTCCGTGATGGATGGTGAAAA
GAGGGATGAAAAAGATGGTTCTAAGAGCTTGGATGATGGTAAAATGATCC
GAGTATGTGACAAGCTCATTGAGGTTTTCATGGTTGACAAGCCTACACCG
ACTGACTGGAGAAGGTTGCTCGTTTTCAGCAAGGAATGGAACAACCTAAG
GTCTAATTTCTTCAAGCGTTGTCAGGACCGAGCAGACGCTGAGGTGGATC
CTGAAATGAAGCACAAGCTTCTCCGGCTTGGAAGGAAGCTGAAAGAGATT
GATGAAGATGTGCAAAGACACAATGAACTTCTTGAAGTGATCAAGGCAGC
ACCATCAGAAGTAAGTCAAATAGTTTCCAGGCGTCGTAAGGATTTCACTC
AAGAATTTTTTGAGCATCTTCACACTGTAGCAGAATCGTATTACAATGAT
CCAGCC
back to top