FC868659

Overview
NameFC868659
Unique NameFC868659
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP_CITUN (Plastid-lipid-associated protein, chloroplastic OS=Citrus unshiu GN=PAP PE=2 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.163e-116
Identity = 216/219 (98.63%), Postives = 219/219 (100.00%), Query Frame = 3
Query:   51 SPKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRADA 707
            SPKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSI+FAGPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQVTDSLV+PENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRADA
Sbjct:   89 SPKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIQFAGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQVTDSLVLPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRADA 307          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: LIPC_SOLTU (Light-induced protein, chloroplastic OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 369.007 bits (946), Expect = 1.380e-101
Identity = 185/218 (84.86%), Postives = 205/218 (94.04%), Query Frame = 3
Query:   54 PKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRADA 707
            PKE +EI+ LKK L DS YGT+RGL+A+SETRAEIVELITQLE+KNP PAPTEALTLLN KWIL YTSFSGLFPLLSRG LPL RVEEISQTIDSE+FTVQNS+ FAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+TDS+V+PENVEFLGQKIDLSPFKG+++SVQDTASSVAK+ISSQPP+KF I+N+NAQSWLLTTYLD++LRISR DA
Sbjct:   93 PKEPSEIELLKKQLADSLYGTNRGLSASSETRAEIVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLPLVRVEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISSQPPIKFPITNNNAQSWLLTTYLDDELRISRGDA 310          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: LIPC_SOLDE (Light-induced protein, chloroplastic OS=Solanum demissum PE=1 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.399e-100
Identity = 182/218 (83.49%), Postives = 203/218 (93.12%), Query Frame = 3
Query:   54 PKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRADA 707
            PKE +EI+ LKK L DS YGT+RGL+A+SETRAEIVELITQLE+KNP PAPTEALTLLN KWIL YTSFSGLFPLLSRG LPL RVEEISQTIDSE+FTVQNS+ FAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+TDS+V+PENVEFLGQKID+SPFKG+++SVQDTASSV K+ISSQPP+KF I+N+NAQSWLLTTYLD++LRI R DA
Sbjct:   93 PKEPSEIELLKKQLADSLYGTNRGLSASSETRAEIVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLPLVRVEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDVSPFKGLITSVQDTASSVVKSISSQPPIKFPITNNNAQSWLLTTYLDDELRIPRGDA 310          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: CHRC_CUCSA (Chromoplast-specific carotenoid-associated protein, chromoplast OS=Cucumis sativus GN=CHRC PE=1 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 3.292e-95
Identity = 174/217 (80.18%), Postives = 197/217 (90.78%), Query Frame = 3
Query:   54 PKEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            P E +EI  LKKALVDSFYGTDRGL  + +TRAEIVELITQLE+KNPTPAPTEALTLLN KWIL YT+F+GLFPLLSR  LPL +VEEISQTIDSEN TVQNS++F+GPLATTSI+TNAKFEVRSP RV IKFEEG+IGTPQ+TDS+VIP+NV+FLGQKID +PF GI+SS+QDTAS+VAKTISSQPP+KFSISN+  +SWLLTTYLDEDLRISR D
Sbjct:   90 PLEPSEIYKLKKALVDSFYGTDRGLRVSRDTRAEIVELITQLESKNPTPAPTEALTLLNGKWILAYTTFAGLFPLLSRN-LPLVKVEEISQTIDSENLTVQNSVQFSGPLATTSITTNAKFEVRSPLRVHIKFEEGVIGTPQLTDSIVIPDNVDFLGQKIDFTPFNGIISSLQDTASNVAKTISSQPPIKFSISNTRVESWLLTTYLDEDLRISRGD 305          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP2_BRACM (Plastid lipid-associated protein 2, chloroplastic OS=Brassica campestris GN=PAP2 PE=1 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.529e-92
Identity = 167/216 (77.31%), Postives = 196/216 (90.74%), Query Frame = 3
Query:   57 KEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            + V E + LK++LVDS YGTDRGL+A+SETRAEI +LITQLE+KNPTPAPT+AL LLN KWIL YTSF GLFPLLSRG +PL +V+EISQTIDS+NFTV+NS+ FAGPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQ+TDS+ IPE VEFLGQKIDL+P +G+L+SVQDTA+SVA+TISSQPPLKFS+   +AQSWLLTTYLD+D+RISR D
Sbjct:   87 ESVEETEVLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVDEISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQLTDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLLTTYLDKDIRISRGD 302          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP2_ARATH (Probable plastid-lipid-associated protein 2, chloroplastic OS=Arabidopsis thaliana GN=PAP2 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.608e-92
Identity = 167/216 (77.31%), Postives = 194/216 (89.81%), Query Frame = 3
Query:   57 KEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            ++V E + LK++LVDS YGTDRGL+A+SETRAEI +LITQLE+KNPTPAPTEAL LLN KWIL YTSF  LFPLLSRG +PL +V+EISQTIDS+NFTVQNS+RFAGPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQ+TDS+ IPE VE LGQKIDL+P +G+L+SVQDTASSVA+TISSQPPLKFS+   NAQSWLLTTYLD+D+RISR D
Sbjct:   78 EDVEETERLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLIKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLLTTYLDKDIRISRGD 293          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP1_ARATH (Probable plastid-lipid-associated protein 1, chloroplastic OS=Arabidopsis thaliana GN=PAP1 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 9.277e-90
Identity = 162/216 (75.00%), Postives = 190/216 (87.96%), Query Frame = 3
Query:   57 KEVTEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            + V E + LK++L DS YGTDRGL+ +S+TRAEI ELITQLE+KNPTPAP EAL LLN KWIL YTSF GLFPLLSR   PL +V+EISQTIDS++FTVQNS+RFAGP +TTS STNAKFE+RSPKRVQIKFE+G+IGTPQ+TDS+ IPE+VE LGQKIDL+P KG+L+SVQDTASSVA+TIS+QPPLKFS+ + N QSWLLTTYLD+DLRISR D
Sbjct:   86 ESVEETERLKRSLADSLYGTDRGLSVSSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPLVKVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPESVEVLGQKIDLNPIKGLLTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLLTTYLDKDLRISRGD 301          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP1_BRACM (Plastid lipid-associated protein 1, chloroplastic OS=Brassica campestris GN=PAP1 PE=1 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.340e-88
Identity = 163/212 (76.89%), Postives = 186/212 (87.74%), Query Frame = 3
Query:   69 EIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            E + LK+ L  S YGTDRGL+A+SETRAEI ELITQLE+KNP PAP EAL LLN KWILVYTSF GLFPLLSR   PL +V+EISQTIDS++FTV NS+RFA PLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQ+TDS+ IPE VE LGQKIDL+P KG+L+SVQDTASSVA+TISSQPPLKFS+   +AQSWLLTTYLD+DLRISR D
Sbjct:   99 ETERLKRVLAGSLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFVGLFPLLSRRISPLVKVDEISQTIDSDSFTVHNSVRFASPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQLTDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSWLLTTYLDKDLRISRGD 310          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PAP2_ORYSJ (Probable plastid-lipid-associated protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PAP2 PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.637e-86
Identity = 159/214 (74.30%), Postives = 184/214 (85.98%), Query Frame = 3
Query:   66 TEIDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLP-LARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            +E+  LK  L ++ YGT+RGL A+SETRAE+VELITQLEA+NPTPAPTEALTLLN KWIL YTSFS LFPLL  G+LP L +VEEISQTIDSENFTVQN I+F+GPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQ+TDS+V+PE  E  GQ IDL+P KGI SS+++ ASSVA+TIS QPPLK  I   NA+SWLLTTYLD++LRISR D
Sbjct:   90 SEVAELKAKLKEALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGSLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQLTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWLLTTYLDDELRISRGD 303          
BLAST of FC868659 vs. ExPASy Swiss-Prot
Match: PG1_PEA (Plastoglobulin-1, chloroplastic OS=Pisum sativum GN=PG1 PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 8.764e-56
Identity = 101/211 (47.87%), Postives = 145/211 (68.72%), Query Frame = 3
Query:   72 IDNLKKALVDSFYGTDRGLNATSETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLDEDLRISRAD 704
            ++ LK++LVD+ YGT+ G  A SE RAE+ E + QLEA NPTPAP E   LLN  W+L+YT+ S L PLL+ G+LPL ++++ISQTID+++FTV NS   + P A+ S S +A FEVRSP R+Q+ F+EG +  P++   + +PEN+   GQ++ L P    L  +++  +++++ IS Q PLK  I      SWL+TTYLD+DLRISR D
Sbjct:  132 LEGLKRSLVDTVYGTELGFRARSEVRAEVSEFVAQLEAANPTPAPVEEPDLLNGNWVLLYTASSELLPLLAAGSLPLLKLDKISQTIDTDSFTVVNSTTLSSPFASFSFSVSASFEVRSPTRIQVTFKEGSLQPPEIKSKIDLPENINIFGQQLSLGPLLQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLITTYLDKDLRISRGD 342          
The following BLAST results are available for this feature:
BLAST of FC868659 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
PAP_CITUN1.163e-11698.63Plastid-lipid-associated protein, chloroplastic OS... [more]
LIPC_SOLTU1.380e-10184.86Light-induced protein, chloroplastic OS=Solanum tu... [more]
LIPC_SOLDE3.399e-10083.49Light-induced protein, chloroplastic OS=Solanum de... [more]
CHRC_CUCSA3.292e-9580.18Chromoplast-specific carotenoid-associated protein... [more]
PAP2_BRACM1.529e-9277.31Plastid lipid-associated protein 2, chloroplastic ... [more]
PAP2_ARATH2.608e-9277.31Probable plastid-lipid-associated protein 2, chlor... [more]
PAP1_ARATH9.277e-9075.00Probable plastid-lipid-associated protein 1, chlor... [more]
PAP1_BRACM1.340e-8876.89Plastid lipid-associated protein 1, chloroplastic ... [more]
PAP2_ORYSJ1.637e-8674.30Probable plastid-lipid-associated protein 2, chlor... [more]
PG1_PEA8.764e-5647.87Plastoglobulin-1, chloroplastic OS=Pisum sativum G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003B09EF AbioticL1 Citrus clementina cDNA clone C31003B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868659 ID=FC868659; Name=FC868659; organism=Citrus clementina; type=EST; length=707bp
CGGAGAAGGAGAAGGTGGAAGGTGGCGCTCTGGCGGTGGCAGAGGAGGAG
AGCCCAAAAGAAGTTACAGAGATTGATAATTTGAAGAAAGCGCTTGTGGA
TTCGTTTTATGGGACCGATCGTGGATTGAATGCCACAAGTGAGACGAGGG
CTGAGATCGTTGAGCTTATTACGCAGCTTGAGGCTAAGAATCCAACCCCG
GCTCCCACCGAGGCCTTAACTCTGCTAAATGCCAAATGGATTCTTGTGTA
CACATCTTTTTCAGGTTTGTTTCCGTTGTTGTCAAGGGGAACATTGCCAT
TGGCGAGGGTGGAGGAGATATCTCAGACAATTGACTCAGAGAACTTCACG
GTCCAGAACTCCATCCGGTTTGCTGGGCCATTGGCTACAACTTCCATTAG
TACCAATGCCAAGTTTGAAGTGCGGAGCCCCAAGCGTGTGCAGATCAAGT
TCGAGGAAGGTATCATTGGGACGCCTCAGGTAACTGATTCACTAGTGATA
CCGGAAAATGTCGAATTCTTGGGACAAAAGATTGATCTCTCACCCTTCAA
AGGCATACTCTCTTCAGTCCAAGACACAGCTTCATCTGTTGCAAAGACCA
TTTCTAGCCAACCACCTTTGAAGTTCTCTATCTCTAACAGCAATGCTCAA
TCATGGTTGCTAACCACATACCTTGATGAAGATCTTCGGATTTCAAGGGC
AGATGCT
back to top