FC868665

Overview
NameFC868665
Unique NameFC868665
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length644
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15251 contig Ccv1_Contig15251:12..655. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.015e-97
Identity = 170/181 (93.92%), Postives = 178/181 (98.34%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILI+RNRLKYALTYREVI+ILMQRHVLVD KVRTDKTYPAGFMDV+SIPKTNEN+RLLYDTKGRFRLH IRDE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIK+DLETNKI +FIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 3.856e-97
Identity = 169/181 (93.37%), Postives = 176/181 (97.24%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 353.599 bits (906), Expect = 5.037e-97
Identity = 169/181 (93.37%), Postives = 176/181 (97.24%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.037e-97
Identity = 169/181 (93.37%), Postives = 176/181 (97.24%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 8.591e-97
Identity = 168/181 (92.82%), Postives = 178/181 (98.34%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYREVI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS+RDEE+KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NKI +FIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYREVISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 350.132 bits (897), Expect = 5.569e-96
Identity = 166/181 (91.71%), Postives = 177/181 (97.79%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILI+RNRLKYALTYREVI+ILMQRHVLVD KVRTDKTYPAGFMDV+SIPKT EN+RLLYDTKGRFRL S++DE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDP+IKANDTIK+DLETNKI +FIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.050e-94
Identity = 167/181 (92.27%), Postives = 175/181 (96.69%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHV+VD KVRTDKTYPAGFMDVVSIPKTNE+FRLLYDTKGRF LH+I  +E KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NKI +FIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVV 181          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.050e-90
Identity = 163/181 (90.06%), Postives = 170/181 (93.92%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVV 642
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV++ILMQRH+LVD K+     +     DVVSIPKTNENFRLLYDTKGRFRLHSIRDEE+KFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIT+FIKFDVGNVV
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVV 177          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_ICTPU (40S ribosomal protein S4 OS=Ictalurus punctatus GN=rps4 PE=2 SV=3)

HSP 1 Score: 276.559 bits (706), Expect = 7.824e-74
Identity = 131/180 (72.78%), Postives = 151/180 (83.89%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV 639
            MARG KKHLKR+ APKHWMLDKL G FAP+PS+GPHK RECLPLI+ LRNRLKYALT  EV  I MQR + VD KVRTD TYPAGFMDV+SI KT ENFRL+YD KGRF +H I +EEAK+KLCKV+ +  G KGIP++ T+D RTIRYPDP+IKANDT+++DLET KITEFIKFD GN+
Sbjct:    1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKVDGKVRTDITYPAGFMDVISIEKTGENFRLIYDVKGRFTVHRITNEEAKYKLCKVKKILIGTKGIPHLVTHDARTIRYPDPMIKANDTVRIDLETGKITEFIKFDTGNL 180          
BLAST of FC868665 vs. ExPASy Swiss-Prot
Match: RS4_CRIGR (40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2)

HSP 1 Score: 276.174 bits (705), Expect = 1.022e-73
Identity = 132/180 (73.33%), Postives = 150/180 (83.33%), Query Frame = 1
Query:  100 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV 639
            MARG KKHLKR+ APKHWMLDKL G FAP+PS+GPHK RECLPLI+ LRNRLKYALT  EV  I MQR + +D KVRTD TYPAGFMDV+SI KT ENFRL+YDTKGRF +H I  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLET KIT+FIKFD GN+
Sbjct:    1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITSEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNL 180          
The following BLAST results are available for this feature:
BLAST of FC868665 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 103
Match NameE-valueIdentityDescription
RS4_MAIZE1.015e-9793.9240S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS43_ARATH3.856e-9793.3740S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS42_ARATH5.037e-9793.3740S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS41_ARATH5.037e-9793.3740S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS4_SOLTU8.591e-9792.8240S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS4_ORYSJ5.569e-9691.7140S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_GOSHI1.050e-9492.2740S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4_PRUAR2.050e-9090.0640S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS4_ICTPU7.824e-7472.7840S ribosomal protein S4 OS=Ictalurus punctatus GN... [more]
RS4_CRIGR1.022e-7373.3340S ribosomal protein S4 OS=Cricetulus griseus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003C04EF AbioticL1 Citrus clementina cDNA clone C31003C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868665 ID=FC868665|Name=FC868665|organism=Citrus clementina|type=EST|length=644bp
AGCTAGCAGCGCCTTCGAGTGCATTTAACACTTCGTTTTTGTTTTGCAGG
ACTGTGACACGCCGTTGGCGAATCCACGCTCAGGCTCACGAACACAAAAA
TGGCGAGAGGTTTGAAGAAACATTTGAAGAGGCTTAATGCCCCAAAGCAC
TGGATGCTTGACAAACTTGGTGGAGCATTTGCTCCCAAGCCTTCATCTGG
GCCACACAAATCAAGGGAGTGTTTGCCCTTAATTCTTATCTTACGCAACC
GCTTGAAGTATGCTCTTACATACCGAGAAGTCATTGCAATTTTGATGCAA
CGACATGTGTTGGTTGATGCTAAGGTTCGCACAGATAAGACTTACCCTGC
TGGGTTCATGGATGTTGTGTCAATTCCAAAGACGAATGAGAACTTCCGTC
TCCTTTACGACACCAAGGGCCGGTTCCGCCTTCATTCAATCAGGGATGAG
GAGGCTAAGTTCAAGCTCTGCAAGGTTCGATCAGTGCAATTTGGGCAGAA
GGGAATCCCTTACATCAACACTTATGATGGGAGGACTATTCGCTACCCAG
ACCCACTCATCAAGGCCAATGATACCATCAAGCTGGACCTGGAGACTAAC
AAGATCACCGAGTTCATCAAGTTTGATGTTGGAAATGTTGTGAT
back to top