FC868666

Overview
NameFC868666
Unique NameFC868666
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3538 contig Ccv1_Contig3538:23..736. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.479e-18
Identity = 64/194 (32.99%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEG----SEPVSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLPLIS 711
            AS     L+   V R +DL+S + ++T+ + + + G    S   S VL   P+L+ + LA L     + KG+ +    +L V   K  G      F+ VKLP AL  G   +  V  V+ H L P+P +ITQ++ Q VVF+ + ++ +PY  K Q++ VKL    +ESY KL N       + YGP++++P  S
Sbjct:   25 ASSEAPPLVNEDVKRTVDLSSHLAKVTAEVVLVHPGGGSTSRASSFVLALEPELESR-LAHLGV---QIKGEDEE-DNNLEVRETKIKGKSGR--FFTVKLPVALDPGSKISVVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPSRSEDVLDYGPFKDIPAYS 211          
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_PIG (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Sus scrofa GN=RPN1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.932e-18
Identity = 63/191 (32.98%), Postives = 101/191 (52.88%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEGSEP----VSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLP 702
            ASP    L+   V R +DL+S + ++T+ + + + GS       S +L   P+L+ + LA L     + KG+ +  + +L V   K  G      F+ V LP AL  G   +  V  V+ H L+P+P +ITQ++ Q VVF+ + ++ +PY  K QS+ VKL    +ESY KL N       + YGP+ ++P
Sbjct:   25 ASPEALPLVNEDVKRTVDLSSHLAKVTAEVVLAHAGSSSSPRAASFLLALEPELEAR-LAHLGV---QVKGEDEEEN-NLEVRETKIKGKRGR--FFTVTLPVALDPGAKISVTVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKSQSMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVP 208          
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_MACFA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.304e-18
Identity = 60/190 (31.58%), Postives = 95/190 (50.00%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEGSEPVSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLPLIS 711
            AS     LI   V R +DL+S + ++T+ + + + G    S        L+ +  A L     + KG+ +    +L V   K  G      F+ VKLP AL  G   +  V  V+ H L+P+P +ITQ++ Q VVF+ + ++ +PY  K Q++ VKL    +ESY KL N       + YGP+ ++P  S
Sbjct:   24 ASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGSSTSRATSFLLALEPELEARLAHLGVQVKGEDEE-DNNLEVRETKIKGKSGR--FFIVKLPVALDPGAKISVIVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS 210          
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.304e-18
Identity = 64/194 (32.99%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEG----SEPVSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLPLIS 711
            AS     LI   V R +DL+S + ++T+ + + + G    S   S +L   P+L+ + LA L     + KG+ +  + +L V   K  G      F+ VKLP AL  G   +  V  V+ H L P+P +ITQ++ Q VVF+ + ++ +PY  K Q++ VKL    +ESY KL N       + YGP+ ++P  S
Sbjct:   24 ASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEAR-LAHLGV---QVKGEDEEEN-NLEVRETKIKGKSGR--FFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS 210          
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.341e-18
Identity = 63/194 (32.47%), Postives = 102/194 (52.58%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEG----SEPVSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLPLIS 711
            AS     LI   V R +DL+S + ++T+ + + + G    S   S +L   P+L+ + LA L     + KG+ +  + +L V   K  G      F+ V+LP AL  G   +  V  V+ H L+P+P +ITQ++ Q VVF+ + ++ +PY  K Q++ VKL    +ESY KL N       + YGP+ ++P  S
Sbjct:   24 ASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEAR-LAHLGV---QVKGEDEEEN-NLEVRETKIKGKSGR--FFTVRLPVALDPGAKISVIVETVYTHVLQPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYS 210          
BLAST of FC868666 vs. ExPASy Swiss-Prot
Match: RPN1_RAT (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Rattus norvegicus GN=Rpn1 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.252e-17
Identity = 61/194 (31.44%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  142 ASPVLSDLILSKVDRRIDLTSQIVRITSTLKVENEG----SEPVSEVLLAFPDLQVKDLALLKASPHEGKGKVKSLSASLPVENVKPNGMPAALTFYAVKLPKALGKGDSYTFDVLAVFAHALRPFPEKITQADIQLVVFQESAFYLTPYVVKVQSLSVKLPESRIESYXKLENTKIHGSEIKYGPYENLPLIS 711
            AS     L+   V R +DL+S + ++T+ + + + G    +   S VL   P+L+ + LA L     + KG+ +    +L V   K  G      F+ VKLP AL  G   +  V  V+ H L P+P +ITQ++ Q VVF+ + ++ +PY  K Q++ V+L    +ES+ KL N       + YGP++++P  S
Sbjct:   22 ASSEAPPLVNEDVKRTVDLSSHLAKVTAEVVLAHPGGGSTARASSFVLALEPELESR-LAHLGV---QVKGEDEE-DNNLEVRETKMKGKSGR--FFTVKLPVALDPGSKISIVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVRLASRNVESHTKLGNPSRSEDILDYGPFKDIPAYS 208          
The following BLAST results are available for this feature:
BLAST of FC868666 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
RPN1_MOUSE1.479e-1832.99Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
RPN1_PIG1.932e-1832.98Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
RPN1_MACFA4.304e-1831.58Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
RPN1_HUMAN4.304e-1832.99Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
RPN1_PONAB7.341e-1832.47Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
RPN1_RAT1.252e-1731.44Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003C05EF AbioticL1 Citrus clementina cDNA clone C31003C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868666 ID=FC868666|Name=FC868666|organism=Citrus clementina|type=EST|length=714bp
GTCTGGTCTTCTGACTTCTCAGAAGTGATACTCAGGATCTTGTGTAAAAT
CCTAACTTGGGATTTAGGTTTTTCCGCAATGGGAGTACGGAGGAAAATGG
CGCTTAGATTTGATTTAATCATCTTTACCATCCTTTTATTTGCATCGCCT
GTACTCTCCGATCTGATCCTCTCAAAAGTCGATCGACGCATTGATTTGAC
ATCGCAAATTGTACGCATCACTTCAACACTAAAGGTGGAGAATGAGGGTT
CTGAGCCAGTTTCAGAAGTTTTGCTGGCATTTCCTGATCTCCAAGTGAAA
GACCTGGCACTTCTGAAGGCATCCCCTCATGAGGGGAAAGGGAAAGTGAA
AAGTTTGTCTGCTAGCCTCCCTGTTGAAAATGTCAAACCCAATGGAATGC
CAGCAGCCTTGACCTTTTATGCAGTAAAATTACCTAAGGCATTAGGCAAG
GGTGACAGCTACACTTTTGATGTCTTGGCTGTGTTTGCTCATGCATTGCG
ACCATTTCCTGAGAAAATTACGCAGGCTGATATTCAGCTTGTCGTTTTCC
AGGAGAGCGCGTTCTACCTCACTCCTTATGTCGTTAAGGTTCAGTCACTC
AGTGTTAAATTGCCTGAATCTAGAATTGAATCTTATNACAAACTAGAGAA
TACGAAGATCCATGGTTCTGAGATCAAATATGGCCCGTATGAGAACCTCC
CCCTCATCTCATAT
back to top