FC868668

Overview
NameFC868668
Unique NameFC868668
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9375 contig Ccv1_Contig9375:1..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_CHICK (Basic leucine zipper and W2 domain-containing protein 2 OS=Gallus gallus GN=BZW2 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.512e-23
Identity = 62/206 (30.10%), Postives = 105/206 (50.97%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHS---YSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE IAK ++S  S L++ RY DT F+++  G    PG T+ D+ ++     + +   E   +AI        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +  +   +G  P T+   L  DN+V +G+  SF    FK ++ +   + +
Sbjct:    1 MNKNQKPVLTGQRFKTRKRDEKEKFEPTVFRDTIVQGLNEAGSDLEAIAKFLDSAGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDNDKTKMTRHCVFFAEEDHDAIRNYAQVFNKLIRRYKYLEKAFEDEIKKLLLFLKAFSETEQTKLAMLSGILLA---NGTLPATILTSLFTDNIVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_MACFA (Basic leucine zipper and W2 domain-containing protein 2 OS=Macaca fascicularis GN=BZW2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.334e-22
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGER---HSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE +AK ++S  S L++ RY DT F+++  G    PG T+ D+G++    ++ +       E I        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +      +G  P T+   L  D+LV +G+  SF    FK ++ +   + +
Sbjct:    1 MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLG---NGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_HUMAN (Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens GN=BZW2 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.334e-22
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGER---HSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE +AK ++S  S L++ RY DT F+++  G    PG T+ D+G++    ++ +       E I        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +      +G  P T+   L  D+LV +G+  SF    FK ++ +   + +
Sbjct:    1 MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLG---NGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW1_XENTR (Basic leucine zipper and W2 domain-containing protein 1 OS=Xenopus tropicalis GN=bzw1 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.334e-22
Identity = 59/198 (29.80%), Postives = 101/198 (51.01%), Query Frame = 2
Query:  134 KEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSD--LNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLD 721
            ++KPTL G R K RKR+     DP  F D ++Q   +   DLE +AK +++S   L++ RY +T F+++  GG   PG T  DE  R    +   +   E +        K++RR  +L K  E   ++ +  L+ F E+ER KLA+ T +  +   +G    ++   L  +NLV +G+  +F    FK ++ +  ++
Sbjct:    6 QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLNETGNDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADEVIRTDVCVFSAQEDLETMQAFAQVFNKLIRRYKYLEKGFEEEVKKLLLFLKGFSESERNKLAMLTGILLA---NGNLSASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDIN 200          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW1_XENLA (Basic leucine zipper and W2 domain-containing protein 1 OS=Xenopus laevis GN=bzw1 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.334e-22
Identity = 59/198 (29.80%), Postives = 101/198 (51.01%), Query Frame = 2
Query:  134 KEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSD--LNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLD 721
            ++KPTL G R K RKR+     DP  F D ++Q   +   DLE +AK +++S   L++ RY +T F+++  GG   PG T  DE  R    +   +   E +        K++RR  +L K  E   ++ +  L+ F E+ER KLA+ T +  +   +G    ++   L  +NLV +G+  +F    FK ++ +  ++
Sbjct:    6 QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLNETGNDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADEVIRTDVCVFSAQEDLETMQAFAQVFNKLIRRYKYLEKGFEEEVKKLLLFLKGFSESERNKLAMLTGILLA---NGNLSASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDIN 200          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW1_CHICK (Basic leucine zipper and W2 domain-containing protein 1 OS=Gallus gallus GN=BZW1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.743e-22
Identity = 58/198 (29.29%), Postives = 102/198 (51.52%), Query Frame = 2
Query:  134 KEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSD--LNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLD 721
            ++KPTL G R K RKR+     DP  F D ++Q   +   DLE +AK +++S   L++ RY +T F+++  GG   PG T  D+  R    +   +   E +        K++RR  +L K  E+  ++ +  L+ F E+ER KLA+ T +  +   +G    ++   L  +NLV +G+  +F    FK ++ +  ++
Sbjct:    5 QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMTRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGILLA---NGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDIN 199          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_RAT (Basic leucine zipper and W2 domain-containing protein 2 OS=Rattus norvegicus GN=Bzw2 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.276e-22
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGER---HSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE +AK ++S  S L++ RY DT F+++  G    PG T+ D+G++    ++ +       E I        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +      +G  P T+   L  D+LV +G+  SF    FK ++ +   + +
Sbjct:    1 MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSEAEQTKLAMLSGILLG---NGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_MUSMM (Basic leucine zipper and W2 domain-containing protein 2 OS=Mus musculus molossinus GN=Bzw2 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.276e-22
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGER---HSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE +AK ++S  S L++ RY DT F+++  G    PG T+ D+G++    ++ +       E I        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +      +G  P T+   L  D+LV +G+  SF    FK ++ +   + +
Sbjct:    1 MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSEAEQTKLAMLSGILLG---NGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW2_MOUSE (Basic leucine zipper and W2 domain-containing protein 2 OS=Mus musculus GN=Bzw2 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.276e-22
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  125 MSSKEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIES--SDLNFSRYGDTFFEVVFTGGRTQPGTTKPDEGER---HSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLDDL 727
            M+  +KP L G R K RKR+     +P  F D +VQ   +   DLE +AK ++S  S L++ RY DT F+++  G    PG T+ D+G++    ++ +       E I        K++RR  +L K  E+  ++ +  L+ F E E+ KLA+ + +      +G  P T+   L  D+LV +G+  SF    FK ++ +   + +
Sbjct:    1 MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSEAEQTKLAMLSGILLG---NGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSV 203          
BLAST of FC868668 vs. ExPASy Swiss-Prot
Match: BZW1_RAT (Basic leucine zipper and W2 domain-containing protein 1 OS=Rattus norvegicus GN=Bzw1 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.973e-22
Identity = 58/198 (29.29%), Postives = 102/198 (51.52%), Query Frame = 2
Query:  134 KEKPTLGGTRIKPRKRNIAAPLDPAAFSDAVVQIYLDNAGDLELIAKCIESSD--LNFSRYGDTFFEVVFTGGRTQPGTTKPDEGERHSYSIIDCEPQREAILPSVIYIQKILRRRPFLIKNLENVTRRFMQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVGKGLVLSFITDFFKEYLVDNSLD 721
            ++KPTL G R K RKR+     DP  F D ++Q   +   DLE +AK +++S   L++ RY +T F+++  GG   PG T  D+  R    +   +   E +        K++RR  +L K  E+  ++ +  L+ F E+ER KLA+ T +  +   +G    ++   L  +NLV +G+  +F    FK ++ +  ++
Sbjct:    6 QQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLA---NGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDIN 200          
The following BLAST results are available for this feature:
BLAST of FC868668 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
BZW2_CHICK3.512e-2330.10Basic leucine zipper and W2 domain-containing prot... [more]
BZW2_MACFA1.334e-2229.61Basic leucine zipper and W2 domain-containing prot... [more]
BZW2_HUMAN1.334e-2229.61Basic leucine zipper and W2 domain-containing prot... [more]
BZW1_XENTR1.334e-2229.80Basic leucine zipper and W2 domain-containing prot... [more]
BZW1_XENLA1.334e-2229.80Basic leucine zipper and W2 domain-containing prot... [more]
BZW1_CHICK1.743e-2229.29Basic leucine zipper and W2 domain-containing prot... [more]
BZW2_RAT2.276e-2229.61Basic leucine zipper and W2 domain-containing prot... [more]
BZW2_MUSMM2.276e-2229.61Basic leucine zipper and W2 domain-containing prot... [more]
BZW2_MOUSE2.276e-2229.61Basic leucine zipper and W2 domain-containing prot... [more]
BZW1_RAT2.973e-2229.29Basic leucine zipper and W2 domain-containing prot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003C07EF AbioticL1 Citrus clementina cDNA clone C31003C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868668 ID=FC868668|Name=FC868668|organism=Citrus clementina|type=EST|length=727bp
GAGCAAAAATTGGAACGCCACTTTCTCTCTTTTCTCTCATTCCTTCTTTT
TTTCTTAAATTCCCAAAAAGCCCTCACTTGCACAGAGAGTCTCTCCTCTC
TCCGATCCCTCTTCTATTTTGTTTATGAGCTCGAAGGAGAAACCCACTCT
TGGTGGAACGCGGATTAAGCCCCGCAAACGGAATATTGCAGCGCCGCTGG
ACCCTGCAGCTTTTTCGGATGCAGTGGTCCAGATTTATCTGGATAATGCT
GGTGATCTGGAACTTATTGCCAAGTGCATTGAATCTTCTGACCTTAACTT
CTCAAGATACGGTGACACCTTTTTTGAGGTTGTTTTCACAGGAGGCCGTA
CACAACCTGGAACAACAAAACCTGATGAGGGGGAGCGCCACTCTTACTCC
ATAATAGACTGTGAGCCTCAGCGTGAAGCCATTTTACCCTCTGTAATCTA
TATACAGAAGATCCTGAGGCGGAGGCCATTTCTCATAAAGAATCTTGAAA
ATGTTACTCGAAGATTCATGCAGTCATTGGAGCTTTTTGAGGAGAATGAA
AGGAAGAAGCTGGCTATTTTCACAGCACTTGCATTCTCTCAGAAGCTCTC
AGGGCTTCCGCCAGAGACTGTCTTCCAGCCACTGCTTAAGGATAATCTTG
TTGGAAAGGGGCTAGTTCTTTCATTTATAACAGACTTCTTCAAGGAGTAT
CTGGTTGATAATAGCCTTGATGATTTA
back to top