FC868672

Overview
NameFC868672
Unique NameFC868672
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF2_ARATH (ADP-ribosylation factor 2 OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=3)

HSP 1 Score: 203.756 bits (517), Expect = 7.740e-52
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 133.65 bits (335), Expect = 9.837e-31
Identity = 65/68 (95.59%), Postives = 68/68 (100.00%), Query Frame = 2
Query:    5 KLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    7 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_ARATH (ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 7.740e-52
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 133.65 bits (335), Expect = 9.837e-31
Identity = 65/68 (95.59%), Postives = 68/68 (100.00%), Query Frame = 2
Query:    5 KLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    7 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3)

HSP 1 Score: 202.216 bits (513), Expect = 2.252e-51
Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLE 171          

HSP 2 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 2.252e-51
Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 202.216 bits (513), Expect = 2.252e-51
Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_CHLRE (ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 2.252e-51
Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 129.798 bits (325), Expect = 1.420e-29
Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TK  S+LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_DAUCA (ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.841e-51
Identity = 97/98 (98.98%), Postives = 97/98 (98.98%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI DKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEIIDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_SALBA (ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3)

HSP 1 Score: 201.06 bits (510), Expect = 5.017e-51
Identity = 97/98 (98.98%), Postives = 97/98 (98.98%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 130.568 bits (327), Expect = 8.327e-30
Identity = 63/69 (91.30%), Postives = 67/69 (97.10%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKL  +LF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF1_CATRO (ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3)

HSP 1 Score: 201.06 bits (510), Expect = 5.017e-51
Identity = 97/98 (98.98%), Postives = 97/98 (98.98%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDK GLHSLRQRHWYIQSTCATSGEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKHGLHSLRQRHWYIQSTCATSGEGLYEGLD 171          

HSP 2 Score: 129.413 bits (324), Expect = 1.855e-29
Identity = 63/69 (91.30%), Postives = 68/69 (98.55%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILY+LKLGEIVTTIPTIGFNVETVEY+ ISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQYISFTVWDVGGQDKI 74          
BLAST of FC868672 vs. ExPASy Swiss-Prot
Match: ARF_MAIZE (ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.118e-50
Identity = 96/98 (97.96%), Postives = 98/98 (100.00%), Query Frame = 3
Query:  417 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLD 710
            IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCAT+GEGLYEGLD
Sbjct:   74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATTGEGLYEGLD 171          

HSP 2 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 66/69 (95.65%), Postives = 69/69 (100.00%), Query Frame = 2
Query:    2 TKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDRV 208
            TKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD++
Sbjct:    6 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74          
The following BLAST results are available for this feature:
BLAST of FC868672 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
ARF2_ARATH7.740e-52100.00ADP-ribosylation factor 2 OS=Arabidopsis thaliana ... [more]
ARF1_ARATH7.740e-52100.00ADP-ribosylation factor 1 OS=Arabidopsis thaliana ... [more]
ARF_VIGUN2.252e-5198.98ADP-ribosylation factor OS=Vigna unguiculata GN=AR... [more]
ARF2_ORYSJ2.252e-5198.98ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
ARF1_ORYSJ2.252e-5198.98ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
ARF1_CHLRE2.252e-5198.98ADP-ribosylation factor 1 OS=Chlamydomonas reinhar... [more]
ARF1_DAUCA3.841e-5198.98ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1... [more]
ARF1_SALBA5.017e-5198.98ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 P... [more]
ARF1_CATRO5.017e-5198.98ADP-ribosylation factor 1 OS=Catharanthus roseus G... [more]
ARF_MAIZE1.118e-5097.96ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31003C12EF AbioticL1 Citrus clementina cDNA clone C31003C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868672 ID=FC868672|Name=FC868672|organism=Citrus clementina|type=EST|length=711bp
CACCAAGCTTTTCAGTAAGTTATTTGCAAAGAAGGAGATGCGAATTCTTA
TGGTTGGTCTTGATGCAGCTGGTAAAACCACAATTTTATATAAGCTTAAG
TTAGGGGAGATCGTTACCACCATCCCCACCATTGGTTTCAATGTGGAGAC
TGTGGAATACAAGAATATTAGCTTCACTGTCTGGGATGTTGGAGGTCAAG
ACAGGGTAAGCAACATATAGAACACTAAGATTTCCCCTCCAAAATCTTTC
TTTAATTTTATTGAACTATCAACATATTACGTAATTTTAATACATTCAAT
AAGTTTTTGCCTTTTAAAATCTCATTTTAATTCTTTTGGACATTTGTTTT
CCTTATGGTTTCAGTTTTGTTTTCAAAAGTTGTGTGCTAAACTGTCATGT
TGACCTCTTATTTTAGATTCGACCTTTGTGGAGACACTATTTTCAAAATA
CACAAGGTCTTATCTTTGTGGTTGACAGCAATGATCGTGACCGTGTTGTT
GAGGCTAGAGATGAGCTGCACAGGATGTTGAATGAGGATGAGTTGAGGGA
TGCTGTGTTGCTTGTGTTTGCAAACAAACAAGATCTTCCAAATGCAATGA
ATGCTGCCGAGATCACTGACAAGCTTGGCCTTCATTCTCTCCGACAACGT
CACTGGTATATCCAGAGCACTTGTGCCACTTCTGGAGAAGGGCTCTACGA
GGGACTAGACT
back to top