FC868682

Overview
NameFC868682
Unique NameFC868682
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length697
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14546 contig Ccv1_Contig14546:9..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868682 vs. ExPASy Swiss-Prot
Match: LEA14_SOYBN (Desiccation protectant protein Lea14 homolog OS=Glycine max PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.413e-11
Identity = 36/137 (26.28%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  215 EETIGFGKPTADVTAVHIPKINLERADIVIDVXXXXXXXXXXXXXXXXXXVESDGRKLVSGLIPDSGTIHAHGEETVKIPVTLIYDDIKNAYDDIKPGMIIPYKIKVDLIVDVPVFGRLTLPLEKNGEIPIPYKPDI 625
            E+     KP A VT V   +++ +  + +  V                  ++S G+++ SG IPD G++ A     + +PV + +  + +   DI     I Y++ + L++D+PV G  T+PL + GEI +P   D+
Sbjct:   14 EKVTNMPKPEASVTDVDFKRVSRDSVEYLAKVSVSNPYSTPIPICEIKYSLKSAGKEIASGTIPDPGSLKASDTTMLDVPVKVPHSILLSLAKDIGADWDIDYQLDLGLVIDLPVIGNFTIPLSQKGEIKLPTLSDM 150          
The following BLAST results are available for this feature:
BLAST of FC868682 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LEA14_SOYBN6.413e-1126.28Desiccation protectant protein Lea14 homolog OS=Gl... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31003D11EF AbioticL1 Citrus clementina cDNA clone C31003D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868682 ID=FC868682|Name=FC868682|organism=Citrus clementina|type=EST|length=697bp
AAATAGTGGCCTTGTTCTTCGTGGTTGCTGTCTTGAACTCATCAGATCTC
TTTCAAAACTTCATCAACTGTCAGGTATGGCATCATCTGATAAGCCGGAA
GTAGTTGAAAGGGATGTTAAGGAGAAAGGGCACAAGGAGGATGACAAAGA
AGAGGGAAAAGGTGGATTTATCGAAAAAGTCAAGGATTTTATCCATGATA
TTGGTGAAAAGATTGAGGAAACAATTGGATTTGGGAAGCCAACTGCTGAT
GTTACTGCAGTTCACATTCCTAAAATTAATCTTGAAAGGGCAGATATTGT
TATTGACGTGCTCATTAAAAACCCGAATCCTATACCGATCCCTCTAATTG
ACATAAACTACTTGGTTGAGAGTGATGGAAGGAAATTGGTTTCTGGATTG
ATCCCAGATTCTGGAACTATTCATGCACATGGCGAGGAGACTGTCAAAAT
CCCTGTTACTCTGATTTATGATGACATTAAAAATGCATATGATGATATCA
AGCCTGGGATGATTATTCCATATAAGATCAAGGTTGACCTGATTGTAGAT
GTGCCGGTTTTTGGAAGGTTGACTCTTCCACTTGAGAAAAATGGAGAGAT
CCCCATTCCTTACAAGCCCGATATTGATCTCGAGAAGATTAAGTTTGAGA
GATTCTCATTTGAAGAAAACTGTTGCATTCTTCATTTGAAGTTGGAA
back to top