FC868686

Overview
NameFC868686
Unique NameFC868686
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.623e-27
Identity = 73/178 (41.01%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  158 MSTLKVPDLVPPPEQDAKRLKEAFDGLSKFSFSFLGCFCFQ**RVTICXXXXXXXXXCEFVVIGMNLYAGLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEAL--KKSKSGVKRLQVIVEISCASSPYHLAAVRQAYLCSL 685
            M+T++VP+ VP P QD++ LK+A                                              G GTDEKA+  VL QR  SQR+ IR++++ +Y + LID ++SELSGDF  AV+ WT DPAERDA++  + L  +K K  ++ L+VIVEISC +SP HL AVR+AY CSL
Sbjct:    1 MATIRVPNEVPSPAQDSETLKQAI--------------------------------------------RGWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAY-CSL 133          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.503e-22
Identity = 56/103 (54.37%), Postives = 70/103 (67.96%), Query Frame = 2
Query:  365 GLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            G GT+EKA+  +L  R A QR+ IR AY++LY E L+  + SELSGDF+ AV  WTLDPA+RDA +A  A+KKS        VI+EISC  SP  L AVR+AY
Sbjct:   25 GWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKS---TDVYNVIIEISCIHSPEELLAVRRAY 124          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.922e-20
Identity = 63/172 (36.63%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  158 MSTLKVPDLVPPPEQDAKRLKEAFDGLSKFSFSFLGCFCFQ**RVTICXXXXXXXXXCEFVVIGMNLYAGLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            M++LKVP  VP PE DA++L +AF                                            +G GT+EK +  +L+ R A+QR LIR  Y   YNE L+  +  ELS DF+ AV++WTLDP ERDA +AKE+   +K   K   V+VEI+C      L  V+QAY
Sbjct:    1 MASLKVPSNVPLPEDDAEQLHKAF--------------------------------------------SGWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKES---TKMFTKNNWVLVEIACTRPALELIKVKQAY 125          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.282e-20
Identity = 59/172 (34.30%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  158 MSTLKVPDLVPPPEQDAKRLKEAFDGLSKFSFSFLGCFCFQ**RVTICXXXXXXXXXCEFVVIGMNLYAGLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            M+TLKV D VP P  DA++L+ AF+G                                             GT+E  +  +L+ R+A QR++IRQAY   Y E L+  +  ELS DF+ A+++WTL+P ERDA +A EA K+  S     QV++E++C  +   L   RQAY
Sbjct:    1 MATLKVSDSVPAPSDDAEQLRTAFEGW--------------------------------------------GTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSS---NQVLMEVACTRTSTQLLHARQAY 125          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.734e-19
Identity = 60/172 (34.88%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  158 MSTLKVPDLVPPPEQDAKRLKEAFDGLSKFSFSFLGCFCFQ**RVTICXXXXXXXXXCEFVVIGMNLYAGLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            M++LKVP  VP PE+DA++L +AF G                                             GT+E+ +  +L+ R A+QR  IR  Y   YN+ L+  +  ELSGDF+ AV++WT +PAERDA +AKE+   +K   K   V+VEI+C  S   L   +QAY
Sbjct:    1 MASLKVPATVPLPEEDAEQLYKAFKGW--------------------------------------------GTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKES---TKMFTKNNWVLVEIACTRSALELFNAKQAY 125          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.787e-17
Identity = 54/172 (31.40%), Postives = 81/172 (47.09%), Query Frame = 2
Query:  158 MSTLKVPDLVPPPEQDAKRLKEAFDGLSKFSFSFLGCFCFQ**RVTICXXXXXXXXXCEFVVIGMNLYAGLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            M++LK+P  +P PE+D+++L +AF G                                             GT+E  +  +L+ R A+QR  IR  Y   YN+ L+  +  ELSGDF+  V++WTLDP ERDA +A E+   +K   K + V+VEI+C          +QAY
Sbjct:    1 MASLKIPANIPLPEEDSEQLHKAFKGW--------------------------------------------GTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANES---TKLFTKNIWVLVEIACTRPSLEFFKTKQAY 125          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANXA6_CHICK (Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.745e-11
Identity = 39/103 (37.86%), Postives = 61/103 (59.22%), Query Frame = 2
Query:  365 GLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQVIVEISCASSPYHLAAVRQAY 673
            GLGTDE A+  VL+QR+ +QRQ I +AY+  Y   L+ ++ SELSG   + ++   L PA+ DAK  ++A++   +    L   VEI    +   +AA+ +AY
Sbjct:  376 GLGTDEGAIIEVLTQRSNAQRQQILKAYKAHYGRDLLADLKSELSGSLANLILGLMLTPAQYDAKQLRKAVEGDGTDESTL---VEIMATRNNQEIAAINEAY 475          
BLAST of FC868686 vs. ExPASy Swiss-Prot
Match: ANX13_MOUSE (Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 39/104 (37.50%), Postives = 62/104 (59.62%), Query Frame = 2
Query:  365 GLGTDEKAVTWVLSQRTASQRQLIRQAYQRLYNESLIDNITSELSGDFKDAVIMWTLDPAERDAKMAKEALKKSKSGVKRLQ-VIVEISCASSPYHLAAVRQAY 673
            G+GTDE A+  VLS RT+ +RQ I+Q Y+  Y + L + + SELSG+FK   +     P E  A+  ++A+K    GV   + +++EI C  S   + A+++AY
Sbjct:   30 GMGTDEAAIIEVLSSRTSEERQQIKQKYKEKYGKDLEEVLNSELSGNFKKTALALLDRPNEYAARQLQKAMK----GVGTDEAMLIEILCTRSNKEIVAIKEAY 129          
The following BLAST results are available for this feature:
BLAST of FC868686 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
ANXD3_ARATH1.623e-2741.01Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANX4_FRAAN3.503e-2254.37Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD2_ARATH1.922e-2036.63Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD1_ARATH4.282e-2034.30Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD7_ARATH4.734e-1934.88Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD6_ARATH5.787e-1731.40Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANXA6_CHICK4.745e-1137.86Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1[more]
ANX13_MOUSE6.198e-1137.50Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionC31003E04EF AbioticL1 Citrus clementina cDNA clone C31003E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868686 ID=FC868686|Name=FC868686|organism=Citrus clementina|type=EST|length=687bp
AACAGCCAAAAAAAAGAAAAAGGATTGAACTGAAGAAAGATTAACTTCAC
CTGACAAAACACTCGAAAACTCAAAGACATCTCAGTTTCCCGTCAGGTTT
TTTATTCCCACACTCTCCAGGGGGAAAAAAAAAAAACCATCTGAGAGAAA
AAAAAAAATGTCTACACTAAAAGTGCCAGATCTTGTTCCTCCCCCAGAAC
AAGACGCAAAGAGACTGAAAGAAGCTTTCGATGGTTTATCAAAATTCTCA
TTTTCATTTCTTGGTTGTTTTTGTTTTCAATGATGAAGAGTTACAATATG
TTTATGGTGATCGTAGTCATTGAGTTTATGTGAATTTGTTGTTATTGGAA
TGAATTTGTATGCAGGACTTGGAACTGATGAGAAGGCAGTTACATGGGTA
TTAAGCCAAAGAACTGCAAGCCAAAGGCAGCTAATTAGACAGGCTTATCA
GCGACTTTACAATGAATCCCTCATTGATAATATCACTTCTGAACTCTCTG
GTGATTTTAAGGATGCAGTGATTATGTGGACTTTAGATCCTGCAGAAAGG
GATGCGAAAATGGCAAAGGAAGCGTTGAAGAAGAGCAAGTCAGGTGTTAA
GCGCCTACAAGTGATTGTGGAAATATCATGTGCTTCATCTCCTTACCATC
TGGCAGCAGTGAGGCAGGCCTATTTGTGCTCTCTTTG
back to top