FC868740

Overview
NameFC868740
Unique NameFC868740
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15299 contig Ccv1_Contig15299:30..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7B_ARATH (Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 1.735e-99
Identity = 173/203 (85.22%), Postives = 191/203 (94.09%), Query Frame = 1
Query:   97 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            MS S++D+P +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRVVTALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFA MGSGSLAAM++FE+KYKEGLT+DEGI+LV +AICSGIF
Sbjct:    1 MSQSSVDIPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAEAICSGIF 203          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7A_ARATH (Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2)

HSP 1 Score: 360.533 bits (924), Expect = 5.047e-99
Identity = 172/203 (84.73%), Postives = 190/203 (93.60%), Query Frame = 1
Query:   97 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            MS S +DVP +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRV+TALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFA MGSGSLAAM++FE+KYKEGLT+DEGI+LV ++ICSGIF
Sbjct:    1 MSQSTVDVPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAESICSGIF 203          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_DICDI (Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.695e-76
Identity = 131/194 (67.53%), Postives = 164/194 (84.54%), Query Frame = 1
Query:  124 SRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            +RGGF FDLC RN++L K G+ +  F KTGTTIVG++++ GV+LGADTRATEGPIV DKNCEKIHY+A NIYCCGAGTAADTE+ T ++SS+L+LH+  TG+++RV+TALT+LK+ LF YQG++ AAL+LGG+D  GP LHTIYPHGSTD LP+  MGSGSLAAMA+FE+KYK  +TK+E I LV +AI SGIF
Sbjct:    5 NRGGFDFDLCNRNNVLEKTGLRMKGFMKTGTTIVGVVYKGGVVLGADTRATEGPIVADKNCEKIHYIADNIYCCGAGTAADTESATALISSKLKLHKLSTGKQTRVITALTMLKQMLFKYQGHISAALILGGIDINGPSLHTIYPHGSTDQLPYVTMGSGSLAAMAVFEAKYKNDMTKEEAIALVAEAISSGIF 198          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_PIG (Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 2.210e-70
Identity = 130/206 (63.11%), Postives = 162/206 (78.64%), Query Frame = 1
Query:  106 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K++  + ++E  QLV +AI +GIF
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPEMEEEEAKQLVSEAIAAGIF 207          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_MOUSE (Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.769e-70
Identity = 128/207 (61.84%), Postives = 161/207 (77.78%), Query Frame = 1
Query:   97 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            M+  ++  P  GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K++  + ++E  +LV +AI +GIF
Sbjct:    1 MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIF 207          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_HUMAN (Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.769e-70
Identity = 127/207 (61.35%), Postives = 160/207 (77.29%), Query Frame = 1
Query:   97 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            M+  ++  P  GGFSFD CRRN +L    AK+G  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K++  + ++E   LV +AI +GIF
Sbjct:    1 MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIF 207          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_BOVIN (Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.923e-70
Identity = 129/206 (62.62%), Postives = 162/206 (78.64%), Query Frame = 1
Query:  106 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K++  + ++E  +LV +AI +GIF
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAVLEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIF 207          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_RAT (Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.097e-69
Identity = 126/196 (64.29%), Postives = 156/196 (79.59%), Query Frame = 1
Query:  130 GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K++  + ++E  +LV +AI +GIF
Sbjct:   12 GGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIF 207          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB7_SCHPO (Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe GN=SPAC23D3.07 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.177e-61
Identity = 112/196 (57.14%), Postives = 149/196 (76.02%), Query Frame = 1
Query:  118 VPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIF 705
            +  R GF F+  +RN +L +KG   P    TGTTIVG+I +D ++LGADTRAT GPI+ DKNC+K+H ++PNI+C GAGTAADTE VT M+SS ++LH  +T R+ RVVTALT+LK+HLF YQG++ A LVLGG DC GPHL TI  HGS+D LP+  +GSGSLAA+++ E+KY+  L + E ++LV +AI +GIF
Sbjct:    4 INERKGFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLFRYQGHIGAYLVLGGYDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKYQPDLERHEAMELVKEAIEAGIF 199          
BLAST of FC868740 vs. ExPASy Swiss-Prot
Match: PSB10_HUMAN (Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.659e-57
Identity = 106/194 (54.64%), Postives = 142/194 (73.20%), Query Frame = 1
Query:  127 RGGFSFDLCRRNDMLAK--KGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYV*AALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGI 702
            RGGFSF+ C+RN  L +   G+ +P  RKTGTTI GL+FQDGVILGADTRAT   +V DK+CEKIH++AP IYCCGAG AAD E  T MV+S+++LH   TGRE RV T   +L++ LF YQG+V A+L++GGVD TGP L+ ++PHGS   LPF  +GSG  AA+A+ E +++  +T +    L+V+A+ +GI
Sbjct:    9 RGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGI 202          
The following BLAST results are available for this feature:
BLAST of FC868740 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
PSB7B_ARATH1.735e-9985.22Proteasome subunit beta type-7-B OS=Arabidopsis th... [more]
PSB7A_ARATH5.047e-9984.73Proteasome subunit beta type-7-A OS=Arabidopsis th... [more]
PSB7_DICDI2.695e-7667.53Proteasome subunit beta type-7 OS=Dictyostelium di... [more]
PSB7_PIG2.210e-7063.11Proteasome subunit beta type-7 OS=Sus scrofa GN=PS... [more]
PSB7_MOUSE3.769e-7061.84Proteasome subunit beta type-7 OS=Mus musculus GN=... [more]
PSB7_HUMAN3.769e-7061.35Proteasome subunit beta type-7 OS=Homo sapiens GN=... [more]
PSB7_BOVIN4.923e-7062.62Proteasome subunit beta type-7 OS=Bos taurus GN=PS... [more]
PSB7_RAT1.097e-6964.29Proteasome subunit beta type-7 OS=Rattus norvegicu... [more]
PSB7_SCHPO4.177e-6157.14Probable proteasome subunit beta type-7 OS=Schizos... [more]
PSB10_HUMAN3.659e-5754.64Proteasome subunit beta type-10 OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004C02EF AbioticL1 Citrus clementina cDNA clone C31004C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868740 ID=FC868740|Name=FC868740|organism=Citrus clementina|type=EST|length=721bp
TAAGACTCGAACTCGCTCGCTGTCGCTGCTGCTCTCCAAAGCTCACGCCT
TGTTTTCATTCCAGTGGGATCAATCTCAGGTTGAAGAAAGTTTAAAATGT
CAAACTCTGCAATAGATGTTCCTTCCAGGGGTGGATTTAGTTTTGATCTC
TGCCGGCGGAATGATATGCTTGCAAAGAAGGGTGTCAACCTTCCATCTTT
CCGAAAGACGGGGACGACCATTGTTGGGTTGATTTTCCAGGATGGCGTCA
TTCTTGGGGCAGATACCAGAGCAACTGAAGGACCCATAGTTTGCGATAAG
AATTGTGAGAAAATTCATTACATGGCTCCAAACATATATTGTTGTGGTGC
AGGAACTGCTGCTGACACAGAGGCTGTAACTGACATGGTCAGCTCACAGC
TGCAGTTACATCGTTATCATACTGGTAGAGAGTCAAGGGTTGTTACAGCA
CTGACTCTTCTCAAGAAGCACCTTTTCAACTACCAAGGTTATGTGTAAGC
TGCTTTGGTTCTTGGTGGAGTTGATTGCACTGGACCTCATCTTCACACAA
TATATCCACATGGTTCAACTGACACTTTACCATTTGCGAACATGGGTTCT
GGTTCTCTTGCTGCCATGGCTATGTTTGAATCAAAATACAAAGAAGGCCT
GACTAAAGATGAGGGAATACAGCTAGTTGTGGACGCCATTTGCTCTGGTA
TATTCATGACTTGGGAAGTGG
back to top