FC868750

Overview
NameFC868750
Unique NameFC868750
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15311 contig Ccv1_Contig15311:6..733. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: VP241_ARATH (Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana GN=VPS24-1 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.010e-79
Identity = 150/183 (81.97%), Postives = 167/183 (91.26%), Query Frame = 3
Query:  177 MEKVMNMIKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKVXDCIAGETAAQLP 725
            ME+VMN+IKPKP+P+QLLRDWQRKLRQECRNIERQIRDIQ+EE+NVQKAIK+AAKRNDM SAK+LA+E+V SR+TVNRLYENKAQMNSISMHLGESVAIARTVGHL+KSAEVMKLVNNLMKAP++AATMQEFSKEMTKAGVIEEFVN+A+D ALDS          VDKV   IAGETAA+LP
Sbjct:    1 MERVMNIIKPKPDPKQLLRDWQRKLRQECRNIERQIRDIQKEERNVQKAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLSKSAEVMKLVNNLMKAPQMAATMQEFSKEMTKAGVIEEFVNEAIDNALDSEDMEEEIDEEVDKVLTAIAGETAAELP 183          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: VP242_ARATH (Putative vacuolar protein sorting-associated protein 24 homolog 2 OS=Arabidopsis thaliana GN=VPS24-2 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.316e-51
Identity = 105/152 (69.08%), Postives = 124/152 (81.58%), Query Frame = 3
Query:  270 IERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKVXDCIAGETAAQLP 725
            I+  + DI+REE+NV KAIKD+ KRND+ +AK+LA+E+V SR+TV RLYENKAQ+NSISMHLGES+A A TVG+L+KS EVMKLVN+LMKAPE+A TMQ FSKEMTK GVIEEFV+DAVD ALDS          VDKV   IAGETAA+LP
Sbjct:    3 IKSLLSDIEREERNVHKAIKDSVKRNDLVTAKALAREIVSSRRTVKRLYENKAQVNSISMHLGESIATAVTVGNLSKSGEVMKLVNSLMKAPEIAVTMQAFSKEMTKTGVIEEFVSDAVDNALDSEDIEEEIEEEVDKVLTAIAGETAAELP 154          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_RAT (Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Vps24 PE=1 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_PONAB (Charged multivesicular body protein 3 OS=Pongo abelii GN=VPS24 PE=2 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_MOUSE (Charged multivesicular body protein 3 OS=Mus musculus GN=Vps24 PE=1 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_MACFA (Charged multivesicular body protein 3 OS=Macaca fascicularis GN=VPS24 PE=2 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIRATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_BOVIN (Charged multivesicular body protein 3 OS=Bos taurus GN=VPS24 PE=2 SV=4)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_HUMAN (Charged multivesicular body protein 3 OS=Homo sapiens GN=VPS24 PE=1 SV=3)

HSP 1 Score: 147.132 bits (370), Expect = 8.840e-35
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P++L+ +W  K+R+E R ++RQIRDIQREE+ V++++KDAAK+        LA+E++RSRK V++LY +KA MNS+ M +   +A+ R  G L KS EVMK + +L+K PE+ ATM+E SKEM KAG+IEE + D  ++  D           +D++
Sbjct:   12 PKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_XENLA (Charged multivesicular body protein 3 OS=Xenopus laevis GN=vps24 PE=2 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 3.359e-34
Identity = 70/157 (44.59%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P+ L+ +W  K+R+E R I+RQIRDIQRE++ V+++IK++AK+ +  +   LA+E+V+S+K VN+LY +KA MNS+ M +   +A+ R  G L KS EVMK + NL+K PE+ ATM+E SKEM KAG+IEE + D  +   D           +D++
Sbjct:   12 PKDLVNEWSLKIRKEMRVIDRQIRDIQREQEKVKRSIKESAKKGNREACVILAKEVVQSKKAVNKLYASKAHMNSVLMSMKNQLAVLRVSGSLQKSTEVMKAMQNLVKLPEIQATMRELSKEMMKAGIIEEMLEDTFEGMEDQDEMEEQAEMEIDRI 168          
BLAST of FC868750 vs. ExPASy Swiss-Prot
Match: CHMP3_DANRE (Charged multivesicular body protein 3 OS=Danio rerio GN=vps24 PE=2 SV=3)

HSP 1 Score: 144.821 bits (364), Expect = 4.387e-34
Identity = 69/157 (43.95%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  216 PQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDMSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSXXXXXXXXXXVDKV 686
            P+ L+ +W  K+R+E R I+RQIRDIQREE+ V+++IKDAAK+        LA+E+++S++ +N+LY +KAQMNS+ + +   +++ R  G L KS EVMK + +L+K PE+ ATM++ SKEM KAG+IEE + D ++   D           VDK+
Sbjct:   12 PKDLINEWSLKIRKEMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCIILAKEMIQSKRAINKLYASKAQMNSVLLSMKNQLSVLRVAGALQKSTEVMKAMQSLVKIPEIQATMRDLSKEMMKAGIIEEMLEDTLEGMDDEEEMEEAAEAEVDKI 168          
The following BLAST results are available for this feature:
BLAST of FC868750 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
VP241_ARATH2.010e-7981.97Vacuolar protein sorting-associated protein 24 hom... [more]
VP242_ARATH2.316e-5169.08Putative vacuolar protein sorting-associated prote... [more]
CHMP3_RAT6.769e-3544.59Charged multivesicular body protein 3 OS=Rattus no... [more]
CHMP3_PONAB6.769e-3544.59Charged multivesicular body protein 3 OS=Pongo abe... [more]
CHMP3_MOUSE6.769e-3544.59Charged multivesicular body protein 3 OS=Mus muscu... [more]
CHMP3_MACFA6.769e-3544.59Charged multivesicular body protein 3 OS=Macaca fa... [more]
CHMP3_BOVIN6.769e-3544.59Charged multivesicular body protein 3 OS=Bos tauru... [more]
CHMP3_HUMAN8.840e-3544.59Charged multivesicular body protein 3 OS=Homo sapi... [more]
CHMP3_XENLA3.359e-3444.59Charged multivesicular body protein 3 OS=Xenopus l... [more]
CHMP3_DANRE4.387e-3443.95Charged multivesicular body protein 3 OS=Danio rer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004C12EF AbioticL1 Citrus clementina cDNA clone C31004C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868750 ID=FC868750|Name=FC868750|organism=Citrus clementina|type=EST|length=727bp
AGGCGTCCAGCGATCGATCGTTGCTGGACCTCAGAAAAATAAAAATTCAG
AAAAAAAAAGATACGAATTTGGATTGCGTTTGATGTTCAATTGATCGGTT
GCTGGAAAAAGAGAAGACTTCGAAGATCAGACGAGAAAAATTAGAAAAAA
ATAATAGAGATAAAAAAGCTAAGGAAATGGAAAAAGTTATGAACATGATA
AAGCCAAAGCCTAATCCGCAACAGCTGTTGAGGGATTGGCAACGTAAGCT
TCGCCAAGAGTGCCGGAACATTGAGCGCCAAATTCGAGATATACAGAGAG
AAGAGAAAAATGTGCAGAAAGCAATTAAAGATGCTGCCAAGAGAAACGAC
ATGAGCTCTGCCAAGTCTCTGGCTCAGGAACTCGTCAGATCTAGAAAGAC
AGTTAACCGTCTCTATGAAAATAAGGCACAAATGAACTCAATATCGATGC
ACCTAGGAGAAAGTGTAGCGATTGCTCGTACTGTGGGGCATTTGAACAAG
AGTGCTGAGGTTATGAAACTTGTCAACAATCTCATGAAGGCACCAGAAGT
AGCTGCTACAATGCAAGAGTTCAGCAAAGAAATGACCAAGGCTGGAGTAA
TTGAGGAGTTTGTGAATGATGCTGTTGATACAGCACTGGACTCGGAGGAT
ATTGAAGAGGAGATAGAAGAAGAAGTTGATAAGGTCTTNGACTGCATTGC
TGGTGAGACTGCAGCACAGCTGCCTGA
back to top