FC868761

Overview
NameFC868761
Unique NameFC868761
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10289 contig Ccv1_Contig10289:3..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868761 vs. ExPASy Swiss-Prot
Match: BPS1_ARATH (Protein BPS1, chloroplastic OS=Arabidopsis thaliana GN=BPS1 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.804e-81
Identity = 144/216 (66.67%), Postives = 180/216 (83.33%), Query Frame = 1
Query:   76 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSSPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYGVKVLTVFVCSIFAAAFSG 723
            M+RPQDP R FFPFGNPF+ +S K S LS KL+ LL +FE  LA  + KL+PK+K DIL +SWM+ AMESLCETHN IK LIT+LELPVSDW++KW+DVYLDISV LLD+C AFSS LT+++QGHLLLQ  LH L+++SP    +A SSLD+W++HI SKNPR+E+CR+IL +LV +L+LPKVKNSAKGKVLMRA+YGVKV T+++  +FAAAFSG
Sbjct:    1 MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLASSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPRIENCRAILSSLVQTLNLPKVKNSAKGKVLMRALYGVKVKTLYISGVFAAAFSG 216          
BLAST of FC868761 vs. ExPASy Swiss-Prot
Match: U496D_ORYSI (UPF0496 protein 4 OS=Oryza sativa subsp. indica GN=OsI_033149 PE=3 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.890e-61
Identity = 124/220 (56.36%), Postives = 150/220 (68.18%), Query Frame = 1
Query:   76 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYGVKVLTVFVCSIFAAAFSG 723
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  + PR+ SC + L  L  +L L KVKNS KGKVLMRA+YG++ +TVFVCSIF A  SG
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCPRLVSCSATLQELAGNLSLMKVKNSVKGKVLMRALYGIESVTVFVCSIFVAVLSG 220          
BLAST of FC868761 vs. ExPASy Swiss-Prot
Match: U496D_ORYSJ (UPF0496 protein 4 OS=Oryza sativa subsp. japonica GN=Os10g0513300 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.499e-61
Identity = 124/220 (56.36%), Postives = 150/220 (68.18%), Query Frame = 1
Query:   76 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYGVKVLTVFVCSIFAAAFSG 723
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  +  R+ SC + L  L  +L L KVKNSAKGKVLMRA+YG++ +TVFVCSIF A  SG
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCARLVSCSATLQELAGNLSLMKVKNSAKGKVLMRALYGIESVTVFVCSIFVAVLSG 220          
The following BLAST results are available for this feature:
BLAST of FC868761 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
BPS1_ARATH2.804e-8166.67Protein BPS1, chloroplastic OS=Arabidopsis thalian... [more]
U496D_ORYSI1.890e-6156.36UPF0496 protein 4 OS=Oryza sativa subsp. indica GN... [more]
U496D_ORYSJ5.499e-6156.36UPF0496 protein 4 OS=Oryza sativa subsp. japonica ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004E01EF AbioticL1 Citrus clementina cDNA clone C31004E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868761 ID=FC868761|Name=FC868761|organism=Citrus clementina|type=EST|length=724bp
GGACGCAATAGTGTCTCTAACGCCTCTGCGAAATTTCCTAAGATTTTCGA
GTACTGATTTCGCAAATCCATCAAAATGAGTCGCCCCCAGGATCCACACC
GTCCTTTCTTCCCATTTGGAAATCCTTTTCGGATGATGTCCCCCAAAGGT
TCTCGTTTGTCTCCCAAGCTTGTATCTCTGTTGGCTGATTTTGAGGAGAC
CTTGGCAGAGAGGCTGAGAAAACTTATGCCGAAAGACAAGGATGATATCC
TCAACTTATCATGGATGAGACTGGCAATGGAGTCACTTTGTGAGACTCAC
AATGTCATAAAAGACCTTATAACTGAGTTGGAGCTTCCTGTAAGTGACTG
GGATGAGAAATGGATAGACGTGTACTTAGACATCAGTGTAAACTTGCTTG
ATATATGCATTGCTTTTAGCTCTGTTCTCACGAAGGTCAGCCAAGGCCAC
CTATTGCTTCAGTGTGTCTTGCACACTTTGGATTCTTCCTCTCCAACACA
GTTTGGGCGAGCCTGTTCTTCTCTTGATAACTGGAGGGAGCACATTAGTT
CAAAGAACCCCAGAGTTGAGAGCTGTCGTTCAATCTTAGACAATCTGGTA
GCTTCTTTGGATTTGCCCAAGGTTAAGAACTCAGCCAAAGGGAAGGTTTT
GATGCGCGCAATGTATGGGGTTAAGGTGTTGACTGTATTTGTTTGTAGTA
TTTTTGCTGCAGCCTTCTCTGGAT
back to top