FC868763

Overview
NameFC868763
Unique NameFC868763
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868763_ssr497 microsatellite FC868763_ssr497:497..508. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig7230 contig Ccv1_Contig7230:57..777. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C71DB_LOTJA (Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.702e-17
Identity = 51/182 (28.02%), Postives = 93/182 (51.10%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLD 718
            H+K  +L+  YGP+  L LG  + ++VSS    K+V++  D TFA R   +   +  +G  DI +S YG  WR++RK    +++S   + + + +R++EVKN I+ + +    +   +++ +   S +        +G+    +E        E    + E+M L G  NI+D+FP   WL+
Sbjct:   41 HRKLRDLAKKYGPLMHLQLGEVIFIIVSSAEYAKEVMKTHDVTFASRPRSLFTDIVFYGSTDIGFSPYGDYWRQVRKICNVELLSMKRVQSLWPIREEEVKNLIQRIASEEGSV---VNLSQAIDSLIFTITSRSAFGKRYMEQE--------EFISCVREVMKLAGGFNIADLFPSAKWLE 211          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.077e-16
Identity = 55/184 (29.89%), Postives = 86/184 (46.74%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKG-TTILGVELKFKLAELMVLLGTPNISDIFPMLSWLDI 721
            H+    ++  YGP+  L +G    VV +S S+  Q ++  D  F+ R P        +   D+ ++ YGP WR LRK     + S  +LD    +R+ EVK   R L +      KP+ +G+L       A+  ++ G+ +     G       E K  + E+MV+ G  NI D  P L+WLDI
Sbjct:   54 HQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQ---KPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVAGVFNIGDFIPQLNWLDI 234          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.653e-15
Identity = 56/187 (29.95%), Postives = 95/187 (50.80%), Query Frame = 2
Query:  170 LHKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELK---FKLAELMVLLGTPNISDIFPMLSWLDI 721
            LH+    L+  YGPI  L  G+   VVVSS    K  ++  D  FA R P   G    +   DIA+S YG  WRK+RK  V +++++  +++   +R++E+   I  ++  +      +++ + +IST   ++ N+LW   L  K+     LG + K     + E+ + +G+ NI D  P L  LD+
Sbjct:   62 LHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSK-AIST---SLANILW-RILARKKFSDNDLGADGKGFADLVVEVSIAVGSLNIGDFIPYLDCLDL 243          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.465e-15
Identity = 62/231 (26.84%), Postives = 103/231 (44.59%), Query Frame = 2
Query:   38 LVSVLAVVYFAWNVKKSRKANAKXXXXXXXXXXXXXXXFLGTTDLHKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEAL---ELKEKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLDI 721
            L +VL ++   ++ +++R  N +                +GT   H+  + +   YGPI  L LG    VV +S S+ +Q ++  D  FA R P        +   D+ ++ YG  WR LRK     + S  +L+    +R++EV    R+L        KP+++G+L    +V A+   + G  L   +   K       E +  + E+M L G  NI D  P L WLD+
Sbjct:   10 LATVLFLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKP-HRTLSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGT---KPVNLGQLVNMCVVNALGREMIGRRLFGADADHKAD-----EFRSMVTEMMALAGVFNIGDFVPSLDWLDL 231          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.910e-15
Identity = 52/184 (28.26%), Postives = 93/184 (50.54%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAW-SNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLDI 721
            H+ F ELS  YGP+  L LG+   VV++SP   ++V+R  D   + R P  A          + W  +    WR LR+  V +++S   ++A  ALR  +VK  +  +  ++++  + +DI  ++  T +  + N+L+   L       +I GV+    +  +M   GTP+ ++ FP L +LD+
Sbjct:   59 HRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFISESSDRE-ESVDISRVAFITTLNIISNILFSVDLGSYNAKASINGVQ--DTVISVMDAAGTPDAANYFPFLRFLDL 239          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.933e-14
Identity = 50/185 (27.03%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  170 LHKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELKFK--LAELMVLLGTPNISDIFPMLSWLD 718
            LH+ F  LS  YG +F LW G++L VVVSS S  +Q     D   A R   ++G    +    +  ++YG  WR LR+     ++SN  +++   +R+ E +  I  L ++++     +++           +  M+ G+    ++  T+ L    +F+  ++EL+ L G  N +D  P+L +LD
Sbjct:   52 LHRTFKGLSEKYGHVFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLITRLADDSSTNFAEMELSSRLYDMTFNNIMRMISGKRYYGEDCDTSDLQEASQFRDMVSELLQLSGANNKTDFMPLLRFLD 236          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.831e-14
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:  155 LGTTDLHKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNK-ICKPIDIGELSISTLVCAMQNMLWGEAL---------ELKEKGTTILGV-ELKFKLAELMVLLGTPNISDIFPMLSWLDI 721
            LGT   H    +++  YGPI  L LG+K  VV S+P   +  ++  D  F+ R          +   D+ ++ YGP+W+ LRK     M+   +L+    ++  EV + ++++Y  ++K +  P+ + E+    L  AM NM+    L         +L    +    V E ++ + ELM + G  NI D  P ++W+D+
Sbjct:   54 LGTMP-HVSLADMAVKYGPIMYLKLGSKGTVVASNPKAARAFLKTHDANFSNRPIDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVKVSEVGHMLKEMYEQSSKSVPVPVVVPEM----LTYAMANMIGRIILSRRPFVITSKLDSSASASASVSEFQYMVMELMRMAGLFNIGDFIPYIAWMDL 248          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C71A3_SOLME (Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.003e-14
Identity = 50/182 (27.47%), Postives = 86/182 (47.25%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLD 718
            H+   +LS  YGP+  L LG+K  +V SS   V+ +++  D  ++ R          +G  D+++S +G  WR++R   V  ++SN  + +  A R++E  N I  L   +N      D+ +L          N++   AL  K        ++ K  L + + LLGT N+ D  P L W++
Sbjct:   46 HRSLHKLSKKYGPVMLLHLGSKPVIVASSVEAVRDIMKTNDLVWSNRPKSKMADRLIYGSKDVSFSPHGEYWRQIRSITVLHLLSNKRVQSYRAAREEETSNMIEKLKQMSNSSSSATDLRDL----FCWLAYNIINRVALGKKYNDE----IDAKATLDKFVELLGTFNVGDYIPCLEWVN 219          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C84A1_ARATH (Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.534e-14
Identity = 56/182 (30.77%), Postives = 88/182 (48.35%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSISTLVCAMQNMLWGEALELKEKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLD 718
            H+    L+  YG +  L +G      VSSP + +QV++ QD+ F+ R   IA    T+   D+A+++YGP WR++RK  V K+ S    ++ +A  + EV   +R +  N   + KPI++GE   +          +G A    EKG      E    L E   L G  N++D  P   W+D
Sbjct:   61 HRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAES-WASVRDEVDKMVRSVSCN---VGKPINVGEQIFALTRNITYRAAFGSAC---EKGQD----EFIRILQEFSKLFGAFNVADFIPYFGWID 231          
BLAST of FC868763 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.115e-13
Identity = 52/189 (27.51%), Postives = 91/189 (48.15%), Query Frame = 2
Query:  173 HKKFTELSGVYGPIFKLWLGNKLCVVVSSPSLVKQVVRDQDTTFAYRDPPIAGLVATFGGNDIAWSNYGPEWRKLRKFFVGKMMSNASLDACYALRKQEVKNTIRDLYNNNNKICKPIDIGELSI--STLVCAMQNMLWGEALELK----EKGTTILGVELKFKLAELMVLLGTPNISDIFPMLSWLDI 721
            H    +++  YGPI  L +G    VV S+P+  K  ++  D  F+ R P        +   D+ ++ YGP W+ LRK     M+   +L+    +R  E+ + ++ +++ ++       +GE  +    L  AM NM+ G+ +  K    EKG  +   E K  + ELM + G  NI D  P ++W+D+
Sbjct:   57 HVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRPPNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDASH-------VGERIVVADMLTFAMANMI-GQVMLSKRVFVEKGKEV--NEFKNMVVELMTVAGYFNIGDFIPQIAWMDL 235          
The following BLAST results are available for this feature:
BLAST of FC868763 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
C71DB_LOTJA3.702e-1728.02Cytochrome P450 71D11 (Fragment) OS=Lotus japonicu... [more]
F3PH_PETHY1.077e-1629.89Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C75A1_PINTA2.653e-1529.95Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
F3PH_ARATH3.465e-1526.84Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C76C1_ARATH5.910e-1528.26Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C81E1_GLYEC2.933e-1427.03Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C75A6_CAMME3.831e-1427.00Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C71A3_SOLME5.003e-1427.47Cytochrome P450 71A3 (Fragment) OS=Solanum melonge... [more]
C84A1_ARATH6.534e-1430.77Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CY... [more]
C75A2_SOLME1.115e-1327.51Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004E03EF AbioticL1 Citrus clementina cDNA clone C31004E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868763 ID=FC868763|Name=FC868763|organism=Citrus clementina|type=EST|length=721bp
GGATGCCAGAAGCAATGAGAGTTCCATTATCACTTGTTTAGTTTCTGTGC
TTGCCGTGGTTTACTTCGCATGGAATGTGAAAAAATCAAGGAAAGCAAAT
GCTAAACTTCCACCAGGACCTCGCGGCTTGCCTGTAGTCGGATACCTCCC
ATTTCTCGGAACTACTGACTTGCACAAGAAATTCACGGAATTATCCGGAG
TTTATGGTCCGATCTTCAAGCTCTGGCTCGGAAATAAATTATGTGTAGTG
GTGAGCTCACCTTCCCTAGTTAAACAAGTGGTTCGTGATCAAGATACAAC
ATTCGCATACCGTGACCCGCCGATCGCTGGACTAGTGGCCACCTTTGGTG
GCAATGATATTGCATGGTCCAATTACGGTCCCGAATGGAGAAAGTTGCGC
AAATTTTTTGTGGGCAAGATGATGAGTAACGCAAGCCTTGATGCTTGTTA
TGCTCTAAGAAAACAAGAGGTTAAAAATACTATCAGGGATTTGTATAACA
ACAACAACAAAATTTGCAAGCCCATTGACATTGGTGAATTGTCGATTTCA
ACACTGGTATGTGCTATGCAGAACATGCTGTGGGGTGAAGCGCTTGAATT
AAAAGAGAAAGGGACCACTATTCTTGGGGTTGAGCTAAAATTTAAGCTTG
CAGAACTCATGGTGCTACTGGGAACACCGAATATTTCGGATATCTTTCCA
ATGCTTTCATGGCTCGACATA
back to top