FC868765

Overview
NameFC868765
Unique NameFC868765
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO2_ORYSJ (Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 4.739e-52
Identity = 117/242 (48.35%), Postives = 151/242 (62.40%), Query Frame = 3
Query:    9 PVLSEPASMRLFSNVGGLQELLEDVTSRAYKIGKGHLQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELI-DRLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNFAGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMDYHPRITLIVAQKRHQTRLFPR 731
            P + +   M + S+   L E L      A    K  LQ+L C MS +  GYK LK I ET++G+ TQC LS  ANK +GQDQY            GGSN +L  + LP   G  + MF+GADVNHP   N  SPSIAAVVA+V+   A++YV R+R Q HR E I +   MC E++  + + N+V+PQ II FRDGVS+GQFDMVLNEEL  ++ A ++ DY P IT+IVA+KRH TRLFP+
Sbjct:  651 PCIVQLLDMEVLSDPHQLFEELNKAKQAAAS-KKQKLQLLFCPMSDQHPGYKTLKLICETQLGIQTQCFLSFLANKQQGQDQYMSNLALKINGKIGGSNIQLFGESLPRISGAPY-MFIGADVNHPSPGNVESPSIAAVVASVD-QGASKYVPRIRAQPHRCEVIQHLGDMCKELIGVFEKRNRVKPQRIIYFRDGVSDGQFDMVLNEELADMEKAIKTKDYSPTITVIVAKKRHHTRLFPK 889          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO3_ORYSJ (Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.477e-45
Identity = 112/245 (45.71%), Postives = 149/245 (60.82%), Query Frame = 3
Query:    9 PVLSEPASMRLFSNVGGLQELLEDVTSRAYKIGKGHLQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKG-KGQDQYXXXXXXXXXXXXGGSNAELI-DRLPYFKGEDHVMFVGADVNHPGASN--KTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNFAGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMDYHPRITLIVAQKRHQTRLFPR 731
            P     ++M + S+   L++ L +    A +  K  LQ+L C M  +  GYK LK + ET++G+ TQC LST A    K QDQY            GGSN +L  D +P    +D  MF+GADVNHP   N  K  PSIAAVVA+V+   A++YV R+R Q HR E I N   +C E++ +Y ++NK +P  II FRDGVS+GQFDMVLNEEL  ++      DY P+IT+IVA+KRH TRLFP+
Sbjct:  683 PCYEHVSNMEVLSDPKSLRDALIEAKRAAEEEDK-KLQLLFCPMLNRCHGYKTLKLMCETELGIQTQCFLSTAAKLDEKRQDQYITNLALKINGKIGGSNMQLDPDSIPVVSAKDF-MFIGADVNHPPPGNVSKDIPSIAAVVASVD-KGASKYVTRIRAQYHRCEMIQNLGDICKELIGAYEKVNKKKPDSIIYFRDGVSDGQFDMVLNEELADMENKIMVGDY-PKITVIVAKKRHHTRLFPK 923          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO7_ORYSJ (Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.170e-42
Identity = 104/239 (43.51%), Postives = 139/239 (58.16%), Query Frame = 3
Query:   33 MRLFSNVGGLQELLEDVTSRAYKIGKGHLQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELIDRLP-----YFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNFAGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLK-MAFRSMDYHPRITLIVAQKRHQTRLFPR 731
            ++L +NVG L+  L+ +   A     G+LQ+LICVM R+  GY  LK I+ET +GVVTQCCL +N +K   Q  +            GG N  L    P      F  E+ VMF+GADV HP   + +SPS+ AVVA++NWP+AN+Y++R+R Q HR E I     M  E+++ +++     P  II FRDGVSE QF  VL EE+  ++    R   Y P IT IV QKRH TRLF R
Sbjct:  683 IQLLNNVGILEGKLKKIQEAA----SGNLQLLICVMERRHQGYADLKRIAETSIGVVTQCCLYSNLSKLTSQ--FLTNLALKINAKLGGCNIALYSSFPCQIPRIFLSEEPVMFMGADVTHPHPLDDSSPSVVAVVASMNWPSANKYISRMRSQTHRKEIIEQLDVMAGELLEEFLKEVGKLPSRIIFFRDGVSETQFYKVLKEEMHAVRTTCSRYPGYKPLITFIVVQKRHHTRLFHR 915          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO12_ORYSJ (Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 8.404e-33
Identity = 86/223 (38.57%), Postives = 115/223 (51.57%), Query Frame = 3
Query:  117 LQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID----RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNF-------------AGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMD--YHPRITLIVAQKRHQTRLFP 728
            LQ+LI +++     Y  +K I ET+VGV+TQCC   +  KG    QY            GG N  L D    ++P       ++F GADV HP      SPSIAAVVA+++WP   +Y   V  Q HR E I N               GM  E+++S+ Q    +P  II +RDG+SEGQF  VL  E+  ++ A  S+   Y P +T +V QKRH TRLFP
Sbjct:  692 LQLLIVILTEISGSYGRIKRICETEVGVITQCCAPKSLQKGG--KQYLENLALKMNVKVGGRNTVLEDALHKKIPILTDRPTIVF-GADVTHPSPGEDASPSIAAVVASMDWPEVTKYKCLVSTQSHREEIISNLYTEVKDPLKGIIRGGMIRELLRSFYQETGQKPSRIIFYRDGISEGQFSQVLLYEMDAIRKACASLQEGYLPPVTFVVVQKRHHTRLFP 911          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: MEL1_ORYSJ (Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.612e-31
Identity = 88/252 (34.92%), Postives = 132/252 (52.38%), Query Frame = 3
Query:   45 SNVGGLQELLEDVTSRAYKI----GKGHLQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSN-----AELIDRLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTE-------------KILNFAGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMD--YHPRITLIVAQKRHQTRLFP 728
            +N   ++  L DV  R  ++    GKG LQ+LI ++      Y  +K + ET +G+V+QCCL  +A++     QY            GG N     A + + +P+      ++F GADV HP     ++ SIAAVVA+++WP   +Y   V  Q HR E             K++N  GM  E++ ++ +    RP+ II +RDGVSEGQF  VL  E+  ++ A  S++  Y P +T +V QKRH TRLFP
Sbjct:  666 TNPNNIENALRDVHRRTSELLAREGKGGLQLLIVILPEVSGSYGKIKRVCETDLGIVSQCCLPRHASRPN--KQYLENVALKINVKVGGRNTVLERAFIRNGIPFVSEVPTIIF-GADVTHPPPGEDSASSIAAVVASMDWPEITKYRGLVSAQPHRQEIIEDLFSVGKDPVKVVN-GGMIRELLIAFRKKTGRRPERIIFYRDGVSEGQFSHVLLHEMDAIRKACASLEEGYLPPVTFVVVQKRHHTRLFP 913          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGOL_ARATH (Argonaute-like protein At2g27880 OS=Arabidopsis thaliana GN=At2g27880 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.989e-30
Identity = 87/242 (35.95%), Postives = 121/242 (50.00%), Query Frame = 3
Query:   60 LQELLEDVTSRAYKIGKGHLQILICVMSRKDDGYKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID----RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNFAGMCLEVVKSYVQLNKVR-------------PQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSM--DYHPRITLIVAQKRHQTRLFP 728
            ++E L D+  RA       LQ+LI ++      Y  +K I ET++G+V+QCC     NK     QY            GG N  L D     +P       ++ +GADV HP     +SPSIAAVVA+++WP  N+Y   V  Q HR E I +   +  +  +  V    +R             PQ II +RDGVSEGQF  VL  E+  ++ A  S+  +Y PR+T ++ QKRH TRLFP
Sbjct:  622 IEEALLDIHKRA-----PGLQLLIVILPDVTGSYGKIKRICETELGIVSQCCQPRQVNKLN--KQYMENVALKINVKTGGRNTVLNDAIRRNIPLITDRPTII-MGADVTHPQPGEDSSPSIAAVVASMDWPEINKYRGLVSAQAHREEIIQDLYKLVQDPQRGLVHSGLIREHFIAFRRATGQIPQRIIFYRDGVSEGQFSQVLLHEMTAIRKACNSLQENYVPRVTFVIVQKRHHTRLFP 855          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO1A_ORYSJ (Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.989e-30
Identity = 87/225 (38.67%), Postives = 116/225 (51.56%), Query Frame = 3
Query:  111 GHLQILICVMSRKDDG-YKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID----RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNF-------------AGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSM--DYHPRITLIVAQKRHQTRLF 725
            G L +LI ++   +   Y  LK I ET +G+V+QCCL+ +  K     QY            GG N  L+D    R+P       ++F GADV HP     +SPSIAAVVA+ +WP   +Y   V  Q HR E I +               GM  E++ S+ +    +PQ II +RDGVSEGQF  VL  EL  ++ A  S+  DY P +T +V QKRH TRLF
Sbjct:  705 GELDLLIAILPDNNGSLYGDLKRICETDLGLVSQCCLTKHVFKMS--KQYLANVALKINVKVGGRNTVLVDALTRRIPLVSDRPTIIF-GADVTHPHPGEDSSPSIAAVVASQDWPEVTKYAGLVSAQAHRQELIQDLFKVWKDPQRGTVSGGMIRELLISFKRATGQKPQRIIFYRDGVSEGQFYQVLFYELDAIRKACASLEADYQPPVTFVVVQKRHHTRLF 926          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO18_ORYSJ (Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.659e-30
Identity = 77/211 (36.49%), Postives = 124/211 (58.77%), Query Frame = 3
Query:  117 LQILICVMSRKDDG---YKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID---RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNFAGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSM-DYHPRITLIVAQKRHQTRLFP 728
            + +L+ VM+   +    Y  +K I ET++GV++QCC +    K +   QY            GG N+  ++    LP       ++F GADV HPG+ ++++PSIA+VVA+ +WP   +Y + VR Q  R E I +   +  E++ ++ + +K+ P+++I +RDGVSEGQF  V+  E+  ++ A++S+    PRIT IV QKRH TRLFP
Sbjct:  745 IDLLLVVMTDDKNNASLYGDVKRICETEIGVLSQCCRAKQVYKERNV-QYCANVALKINAKAGGRNSVFLNVEASLPVVSKSPTIIF-GADVTHPGSFDESTPSIASVVASADWPEVTKYNSVVRMQASRKEIIQDLDSIVRELLNAFKRDSKMEPKQLIFYRDGVSEGQFQQVVESEIPEIEKAWKSLYAGKPRITFIVVQKRHHTRLFP 953          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO1B_ORYSJ (Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 5.637e-29
Identity = 85/223 (38.12%), Postives = 115/223 (51.57%), Query Frame = 3
Query:  117 LQILICVMSRKDDG-YKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID----RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKILNF-------------AGMCLEVVKSYVQLNKVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMD--YHPRITLIVAQKRHQTRLF 725
            L +LI ++   +   Y  LK I ET +G+V+QCCL+ +  K     QY            GG N  L+D    R+P       ++F GADV HP     +SPSIAAVVA+ +WP   +Y   V  Q HR E I +               GM  E++ S+ +    +PQ II +RDGVSEGQF  VL  EL  ++ A  S++  Y P +T +V QKRH TRLF
Sbjct:  744 LDLLIVILPDNNGSLYGDLKRICETDLGLVSQCCLTKHVFKMS--KQYLANVALKINVKVGGRNTVLVDALTRRIPLVSDRPTIIF-GADVTHPHPGEDSSPSIAAVVASQDWPEVTKYAGLVSAQAHRQELIQDLFKVWQDPHRGTVTGGMIKELLISFKRATGQKPQRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTFVVVQKRHHTRLF 963          
BLAST of FC868765 vs. ExPASy Swiss-Prot
Match: AGO11_ORYSJ (Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.256e-28
Identity = 81/210 (38.57%), Postives = 111/210 (52.86%), Query Frame = 3
Query:  159 YKYLKWISETKVGVVTQCCLSTNANKGKGQDQYXXXXXXXXXXXXGGSNAELID----RLPYFKGEDHVMFVGADVNHPGASNKTSPSIAAVVATVNWPAANRYVARVRPQDHRTEKI-------------LNFAGMCLEVVKSYVQLN-KVRPQEIIVFRDGVSEGQFDMVLNEELVPLKMAFRSMD--YHPRITLIVAQKRHQTRLFP 728
            Y  +K + ET++GV+TQCCL+ N                      GG N  L D    R+P       ++F GADV HP A   +SPSIAAVVA+++WP  ++Y   V  Q HR E I             L + GM  E+++S+ + N   +P  II +RDGVSEGQF  VL  E+  ++ A  S++  Y P +T +V QKRH TRLFP
Sbjct:  555 YGRIKRLCETELGVITQCCLARNVQN------------------VGGRNTVLEDALHRRIPLLTDMPTMIF-GADVTHPPAGEDSSPSIAAVVASMDWPEVSKYKCSVSSQSHREEIIADLFTEVKDSQNRLVYGGMIRELIESFRKANGSYKPGRIIFYRDGVSEGQFSQVLLSEMDAIRKACASIEEGYLPPVTFVVVQKRHHTRLFP 745          
The following BLAST results are available for this feature:
BLAST of FC868765 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
AGO2_ORYSJ4.739e-5248.35Protein argonaute 2 OS=Oryza sativa subsp. japonic... [more]
AGO3_ORYSJ1.477e-4545.71Protein argonaute 3 OS=Oryza sativa subsp. japonic... [more]
AGO7_ORYSJ1.170e-4243.51Protein argonaute 7 OS=Oryza sativa subsp. japonic... [more]
AGO12_ORYSJ8.404e-3338.57Protein argonaute 12 OS=Oryza sativa subsp. japoni... [more]
MEL1_ORYSJ4.612e-3134.92Protein argonaute MEL1 OS=Oryza sativa subsp. japo... [more]
AGOL_ARATH2.989e-3035.95Argonaute-like protein At2g27880 OS=Arabidopsis th... [more]
AGO1A_ORYSJ2.989e-3038.67Protein argonaute 1A OS=Oryza sativa subsp. japoni... [more]
AGO18_ORYSJ6.659e-3036.49Protein argonaute 18 OS=Oryza sativa subsp. japoni... [more]
AGO1B_ORYSJ5.637e-2938.12Protein argonaute 1B OS=Oryza sativa subsp. japoni... [more]
AGO11_ORYSJ1.256e-2838.57Protein argonaute 11 OS=Oryza sativa subsp. japoni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004E05EF AbioticL1 Citrus clementina cDNA clone C31004E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868765 ID=FC868765|Name=FC868765|organism=Citrus clementina|type=EST|length=732bp
TGCAGTGGCCTGTCTTATCTGAACCTGCTTCAATGCGTCTGTTCTCTAAT
GTTGGAGGGCTTCAGGAACTCCTTGAAGATGTTACTTCAAGGGCTTACAA
AATTGGCAAAGGTCATCTGCAGATTCTTATTTGTGTAATGTCTCGGAAGG
ATGACGGTTACAAGTATCTCAAGTGGATTTCTGAGACTAAAGTTGGTGTG
GTGACTCAGTGTTGTTTGTCCACGAATGCCAACAAAGGTAAAGGTCAAGA
TCAATATCTTGCCAATCTTGCACTCAAGATCAATGCGAAGCTTGGAGGCA
GCAACGCAGAGCTCATTGACAGGCTGCCTTACTTCAAGGGTGAAGACCAT
GTTATGTTTGTGGGTGCAGATGTTAATCATCCTGGTGCGAGTAACAAAAC
TAGTCCATCTATAGCAGCTGTTGTTGCCACTGTAAATTGGCCTGCTGCAA
ACAGATATGTGGCAAGGGTGCGCCCCCAAGATCATAGGACAGAGAAAATT
CTGAATTTTGCTGGCATGTGCTTGGAGGTTGTTAAATCTTATGTTCAGTT
GAATAAAGTCAGGCCACAAGAGATTATAGTGTTTCGAGATGGAGTAAGCG
AGGGCCAGTTCGATATGGTTCTCAATGAAGAGTTGGTACCACTAAAGATG
GCATTCAGATCAATGGATTACCACCCAAGAATCACACTTATTGTGGCCCA
GAAGCGACATCAAACTCGTCTATTTCCAAGGG
back to top