FC868766

Overview
NameFC868766
Unique NameFC868766
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_METVO (Glutamine synthetase OS=Methanococcus voltae GN=glnA PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.000e-25
Identity = 75/221 (33.94%), Postives = 117/221 (52.94%), Query Frame = 1
Query:   58 DGTNLSGTGEIR-----LMPDLSTRWRIPWQKQEEM---IMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSV 696
            DG+++ G  EI      L PDLST   +PW+  E+    I+ D++ K G+P+E  PR  L++V    KEEF      G E EF++LK+    GK  WVP D   Y      D  + + + ++  L +L   VE  H E   GQ E+   +  A K AD++I  +  ++ +A++ G+LATF+PK      GSG H + S+W +G+  F   D ++ H +S +
Sbjct:   59 DGSSIEGFVEIEDSDMVLKPDLSTLSVLPWRPSEKSVARIICDVYRKNGKPFEGDPRGCLKRVLAEFKEEFKGEYFVGPEPEFFILKN--ENGK--WVPGDDAGYFELEPLDEGNDLRRNIVFALENLGFHVEASHHEVAPGQHEVDFKYDNAVKTADSVITFKTTIKTLAKQSGVLATFMPKPFFGMNGSGMHCNQSIWLDGKPSFY--DENNAHQLSDI 273          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_METJA (Glutamine synthetase OS=Methanocaldococcus jannaschii GN=glnA PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.186e-24
Identity = 69/207 (33.33%), Postives = 105/207 (50.72%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMI---MADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVF 654
            DG++++G       ++ L PDLST   +PW+ +E+ +   + D++     P+E  PR  L+ +   LK+E N     G E EF+LLK         WVP D   Y      D    + ++++  L +L   VE  H E   GQ E+      A K AD++I  +  ++ +A+KHGL ATF+PK      G+G H H S+W NGE  F
Sbjct:   63 DGSSITGFVGIEESDMLLKPDLSTLSVLPWRPEEKSVARVICDVYKDEKTPFEGDPRSRLKAILEELKKEMNGEYFVGPEPEFFLLKRD-PHNPHRWVPADDGGYFDVEPLDDAPDIRRDIVLALENLGFHVEASHHEVAPGQHEVDFKFDNALKTADSVITFKMTIKNIAKKHGLKATFMPKPFFGMNGNGMHCHQSVWFNGEPSF 268          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_PYRHO (Glutamine synthetase OS=Pyrococcus horikoshii GN=glnA PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 8.845e-24
Identity = 71/219 (32.42%), Postives = 107/219 (48.86%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSVG 699
            DG+++ G       ++    D ST   +PW     +       K G+P+E  PR  LR+    L E+  + +  G E EFYL K   + G  E    D   Y      D    + +E+   +    ++ E LH E GK Q EI   H  A K ADN++  + +V+AVA  HGL ATF+PK      G+G H+H+SLW++GEN+F   +  S+  +  +G
Sbjct:   53 DGSSVPGFQGIEDSDLVFKADPSTYVEVPWDNVARVY--GYIYKDGKPYEADPRGVLRRTLERL-EKLGIKVYIGPEPEFYLFK---KNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPYFGLTPEVLHHEVGKAQHEIDFRHDEALKTADNIVSFKYIVKAVAEMHGLYATFMPKPIYGMPGNGMHLHISLWKDGENIFKGEEGLSETALYFIG 265          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA1_DICDI (Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.971e-23
Identity = 72/246 (29.27%), Postives = 118/246 (47.97%), Query Frame = 1
Query:    4 VGLTFACMGMTSAVDGPA-DGTNLSGTGEIRLMPDLSTRWRI-PW-----QKQEEMIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLK------SVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSVGE 702
            V +T  CM +    D    +       GE  L+P  +T+  I P+     Q   E    D   K  +PW  CPR +L++    LK +F + L   FE EFYL+K      S +         +D   + +  + D    + +++   L    + +EQL +E+G GQFEI + +T   +A D  I  R+ + ++A  +G +ATF+PK     +GSG H HLSLW   ++  +  D++ + G+S V +
Sbjct:   86 VSITNVCMSLLCFEDSVTIEALKSENFGEAFLIPITTTKLNILPYCPSHIQIFGEFFYLDNESKKLKPWLLCPRNSLQRAIDRLKNKFGISLKGSFEEEFYLIKKGDNNNSSVASLLNSIEKLDHGTFANYHSLDCYGDILEKITNALEEQGLPIEQLLSESGSGQFEITIDYTDIMEACDRHIIVRQTINSIASYNGYIATFIPKPFDGLVGSGCHAHLSLWDTNDS-NLTPDANGECGLSLVNQ 330          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_METMP (Glutamine synthetase OS=Methanococcus maripaludis GN=glnA PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.390e-23
Identity = 68/219 (31.05%), Postives = 110/219 (50.23%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMI---MADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMS 690
            DG+++ G     + ++ L PDL T   +PW+  E+ +   + D++   G+P+E  PR  L++V     EE       G E EF++LK    +    WVP D   Y      D    + ++++  L +L   VE  H E  +GQ E+      A K AD+++  +  ++ +A + GL ATF+PK      GSG H H S+W NGE  F   D S+++ +S
Sbjct:   58 DGSSIEGFVSIESSDMMLKPDLKTLSVLPWRPTEKSVARVICDVYTTNGKPFEGDPRGCLKRVLAKFDEELGGEFFVGPEPEFFILKE---DACGSWVPADDAGYFDLEPLDGGCDIRRKIVFALENLGFHVEASHHEVAEGQHEVDFKFADAVKTADSVVTFKTTIKTLAAQDGLKATFMPKPFFGINGSGMHCHQSIWLNGEPSFY--DESAQYQLS 271          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_HALVO (Glutamine synthetase OS=Halobacterium volcanii GN=glnA PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.488e-23
Identity = 73/213 (34.27%), Postives = 108/213 (50.70%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEE-----MIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASD 666
            DG+++ G       ++RL PD ST   +PW+K+E      +I    +   GEP+   PR  L++   +  EE    +N   E EF+L +    +G+   V  D   Y   A  D  S V ++++  L S+   +E  H E  +GQ EI   +  A   ADN+   R VVRA+A +H L ATF+PK      GSG H H+SL+++GEN F   D
Sbjct:   63 DGSSIDGFVRIQESDMRLEPDPSTFAVLPWRKKENSAAGRLICDVFNTSTGEPFSGDPRGVLKRA--IEPEELGYDVNVAPEPEFFLFEED-EDGRATTVTNDAGGYFDLAPKDLASDVRRDIIYGLESMGFDIEASHHEVAEGQHEINFTYDDALSTADNVRTFRSVVRAIAAEHDLHATFMPKPIPRINGSGMHTHISLFKDGENAFHDGD 272          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_PYRKO (Glutamine synthetase OS=Pyrococcus kodakaraensis GN=glnA PE=3 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.668e-22
Identity = 72/219 (32.88%), Postives = 108/219 (49.32%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSVG 699
            DG+++ G       ++    D ST   IPW+    +       K  EP++  PR  L++V   L++E  L  + G E EFY+ K   + G  E    D   Y      D    + +E+   +  L +  E LH E GK Q EI   +  A + ADN++  + VV+AVA  HG  ATF+PK      G+G H+H+SLW++GENVF+  D  S   +  +G
Sbjct:   53 DGSSIPGFEGIEDSDLIFKADPSTYAEIPWEGIGRVY--GYIYKGDEPYQADPRGILKRVLERLEKE-GLKAHIGPEPEFYIFK---KNGTWELHIPDSGGYFDLVGLDKAREIRREIALYMPYLGLKPEVLHHEVGKAQHEIDFRYDEALRTADNIVSFKHVVKAVAELHGYYATFMPKPIYGFPGNGMHLHISLWKDGENVFIGEDGLSDTALHFIG 265          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_PYRAB (Glutamine synthetase OS=Pyrococcus abyssi GN=glnA PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.279e-22
Identity = 70/219 (31.96%), Postives = 103/219 (47.03%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSVG 699
            DG+++ G       ++    D  T   +PW     +       K G+P+   PR  L++V   L E   +    G E EFYL K   + G  E    D   Y      D    + +E+   + S  +  E LH E GK Q EI   +  A K ADN+I  + +V+AVA  HGL ATF+PK      G+G H+H+SLW+ GEN+F   +  S+  +  +G
Sbjct:   49 DGSSVPGFQGIEDSDLIFKADPDTYVEVPWDNVARVY--GYIYKDGKPYGADPRGVLKRVIEKLAE-MGIKAYIGPEPEFYLFK---KNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPSFGLVPEVLHHEVGKAQHEIDFRYDEALKTADNIISFKYIVKAVAEVHGLYATFMPKPIYGMPGNGMHLHISLWKEGENIFKGEEGLSETALHFIG 261          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: FLUG_EMENI (Protein fluG OS=Emericella nidulans GN=fluG PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.081e-21
Identity = 65/191 (34.03%), Postives = 94/191 (49.21%), Query Frame = 1
Query:   73 SGTGEIRLMPDLSTRW-RIPWQKQEEMIMADMHLKPGEPWEYCPREALRKVSRLLKEEFNLVLNAGFEIEFYLLKSVL--REGKEEWVPIDFTPYCSTAAYDA--VSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSL 630
            S TG+  L+PDLST    +    +   +M     + GE  E CPR  L  ++  LK+EF +    GFEIE   LK       G+E+W P       S    +   + P+ +E+   L S+ I ++Q HAE+  GQFE  L       A D LI +R+V+  +  KHGL AT  P+      G+ SH H+S+
Sbjct:  497 STTGQFYLIPDLSTLSPNVGIDSKSATVMTWWKSEQGESLEECPRTNLLNINNKLKDEFGIQATCGFEIEVVFLKPTTDPSTGEEDWAPSVTNHSWSQMTRETRRMLPLLEEIAETLASIGIHLQQFHAESAPGQFEFILPPDNPVAAVDTLIKSRQVIANIVEKHGLRATLYPRPYPSAAGTASHAHVSI 687          
BLAST of FC868766 vs. ExPASy Swiss-Prot
Match: GLNA_PYRFU (Glutamine synthetase OS=Pyrococcus furiosus GN=glnA PE=3 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 7.008e-21
Identity = 69/220 (31.36%), Postives = 105/220 (47.73%), Query Frame = 1
Query:   58 DGTNLSG-----TGEIRLMPDLSTRWRIPWQKQEEMIMADMHLKPGEPWEYCPREALRK-VSRLLKEEFNLVLNAGFEIEFYLLKSVLREGKEEWVPIDFTPYCSTAAYDAVSPVFQEVLADLHSLNISVEQLHAEAGKGQFEIALGHTVATKAADNLIFTREVVRAVARKHGLLATFVPKFALDDIGSGSHVHLSLWQNGENVFMASDSSSKHGMSSVG 699
            DG+++ G       ++    D  T   +PW     +       K  +P+   PR  L++ +  L KE +   +  G E EFYL K   + G  E    D   Y      D    + +E+   + S  +  E LH E GK Q EI   +  A K ADN++  + + +AVA  HGL ATF+PK      G+G H+H+SLW++GENVFM  +  S+  +  +G
Sbjct:   49 DGSSVPGFQGIEDSDLVFKADPDTYVEVPWDNVARVY--GFIYKDNKPYGADPRGILKRALEELEKEGYKAYI--GPEPEFYLFK---KNGTWELEIPDVGGYFDILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISLWKDGENVFMGEEGLSEIALHFIG 261          
The following BLAST results are available for this feature:
BLAST of FC868766 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
GLNA_METVO8.000e-2533.94Glutamine synthetase OS=Methanococcus voltae GN=gl... [more]
GLNA_METJA5.186e-2433.33Glutamine synthetase OS=Methanocaldococcus jannasc... [more]
GLNA_PYRHO8.845e-2432.42Glutamine synthetase OS=Pyrococcus horikoshii GN=g... [more]
GLNA1_DICDI1.971e-2329.27Type-1 glutamine synthetase 1 OS=Dictyostelium dis... [more]
GLNA_METMP4.390e-2331.05Glutamine synthetase OS=Methanococcus maripaludis ... [more]
GLNA_HALVO7.488e-2334.27Glutamine synthetase OS=Halobacterium volcanii GN=... [more]
GLNA_PYRKO1.668e-2232.88Glutamine synthetase OS=Pyrococcus kodakaraensis G... [more]
GLNA_PYRAB8.279e-2231.96Glutamine synthetase OS=Pyrococcus abyssi GN=glnA ... [more]
FLUG_EMENI1.081e-2134.03Protein fluG OS=Emericella nidulans GN=fluG PE=1 S... [more]
GLNA_PYRFU7.008e-2131.36Glutamine synthetase OS=Pyrococcus furiosus GN=gln... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004E06EF AbioticL1 Citrus clementina cDNA clone C31004E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868766 ID=FC868766|Name=FC868766|organism=Citrus clementina|type=EST|length=707bp
GGTGTTGGTTTGACATTTGCATGCATGGGAATGACTTCAGCTGTTGATGG
TCCAGCTGATGGGACAAATCTGTCTGGAACTGGTGAGATCAGATTGATGC
CTGATTTATCGACTAGATGGAGAATTCCATGGCAAAAACAAGAGGAGATG
ATTATGGCTGACATGCATCTTAAACCTGGTGAACCGTGGGAATATTGCCC
AAGAGAGGCTCTACGAAAAGTTTCAAGACTTCTGAAAGAGGAGTTTAATT
TGGTACTGAATGCAGGATTTGAAATTGAATTTTATCTCTTAAAGAGTGTA
CTTAGGGAAGGGAAAGAAGAATGGGTGCCAATTGACTTCACACCTTACTG
CTCTACAGCAGCATATGATGCTGTTTCCCCTGTATTTCAAGAAGTCCTCG
CTGACCTTCACTCCTTGAATATTTCTGTGGAACAGTTACATGCAGAAGCT
GGGAAAGGTCAGTTTGAAATTGCTCTGGGCCACACTGTTGCTACAAAAGC
TGCTGACAATTTGATTTTCACACGTGAAGTTGTAAGGGCTGTTGCAAGGA
AACATGGACTGTTGGCAACTTTTGTTCCAAAGTTTGCATTAGATGACATT
GGTTCTGGATCCCATGTGCATCTCAGCTTGTGGCAGAATGGAGAAAATGT
ATTTATGGCATCTGACAGTTCCTCTAAACATGGAATGTCCTCGGTTGGGG
AGAAAGT
back to top