FC868781

Overview
NameFC868781
Unique NameFC868781
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length749
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9397 contig Ccv1_Contig9397:1..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORA_CUCSA (Protochlorophyllide reductase, chloroplastic OS=Cucumis sativus GN=PORA PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 5.993e-90
Identity = 163/210 (77.62%), Postives = 181/210 (86.19%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            V  A S+PKEGK+S   KDSSLFG+SFS+H K++FSSS LRCKRE +Q+ G +RAQT AT SPAV+ ++P GKKTLRKGSV+ITGASSGLGLATAKALAETGKWH+IMACRDFLKAERAAKSAG+ KENYT+MHLDLASLDSVRQFVD FR+SGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHF           +S YPS
Sbjct:    9 VSPALSIPKEGKSSVCLKDSSLFGISFSDHLKSEFSSSTLRCKRELNQQIGAIRAQTTATESPAVNKATPDGKKTLRKGSVVITGASSGLGLATAKALAETGKWHVIMACRDFLKAERAAKSAGITKENYTVMHLDLASLDSVRQFVDNFRQSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFLLSRLLLEDLNKSSYPS 218          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: POR_PEA (Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.025e-81
Identity = 155/211 (73.46%), Postives = 178/211 (84.36%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVS-FSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +P++FS+PKEGK  AS KDS+LFGVS  S+  K DF+SSALRCK E  Q+ G VRA+T A A+PAV+ SS +GKKTLRKG+V+ITGASSGLGLATAKALAE+GKWH+IMACRD+LKA RAAKSAG+AKENYTIMHLDLASLDSVRQFVD FRRS  PLDVL+ NAAVY PTAKEP+FTA+GFE+SVGTNHLGHF          K+SDYPS
Sbjct:    9 LPASFSIPKEGKIGASLKDSTLFGVSSLSDSLKGDFTSSALRCK-ELRQKVGAVRAETAAPATPAVNKSSSEGKKTLRKGNVVITGASSGLGLATAKALAESGKWHVIMACRDYLKAARAAKSAGLAKENYTIMHLDLASLDSVRQFVDNFRRSEMPLDVLINNAAVYFPTAKEPSFTADGFEISVGTNHLGHFLLSRLLLEDLKKSDYPS 218          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORA_ARATH (Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=2 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 1.479e-80
Identity = 156/216 (72.22%), Postives = 177/216 (81.94%), Query Frame = 3
Query:   99 VPSAFSVPKEGK----TSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNG--VVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            V SAFSV K+GK     S+SFK+SSLFGVS SE +KADF SS+LRCKRE S RN   ++RAQ +AT++P+V  SS   KKTLRKG+V++TGASSGLGLATAKALAETGKWH+IMACRDFLKAERAA+SAGM K++YT+MHLDLASLDSVRQFVD FRR+  PLDVLVCNAAVY PTA +PTFTAEGFELSVG NHLGHF          K SDYPS
Sbjct:    9 VSSAFSVRKDGKLNASASSSFKESSLFGVSLSEQSKADFVSSSLRCKREQSLRNNKAIIRAQAIATSTPSVTKSSLDRKKTLRKGNVVVTGASSGLGLATAKALAETGKWHVIMACRDFLKAERAAQSAGMPKDSYTVMHLDLASLDSVRQFVDNFRRAEMPLDVLVCNAAVYQPTANQPTFTAEGFELSVGINHLGHFLLSRLLIDDLKNSDYPS 224          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: POR_DAUCA (Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.060e-78
Identity = 152/212 (71.70%), Postives = 177/212 (83.49%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQ--RNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PS+FS+ KEGK + S K++SLFGV+FS+  + DFSS  LR +R   Q  + G +R+Q +AT +P+V+ ++ +GKKTLRKGSVIITGASSGLGLATAKALAETGKWH+IMACRDFLKAERAAKSAGM KENYTIMHLDLASLDSVRQFV+TFRRS RPLDVLVCNAAVY PTAKEPT+TA+GFELSVGTNHLGHF           +SDYPS
Sbjct:    9 LPSSFSINKEGKANVSLKETSLFGVTFSDSLRTDFSS--LRTRRGCRQISQTGAIRSQAVAT-TPSVNRATGEGKKTLRKGSVIITGASSGLGLATAKALAETGKWHVIMACRDFLKAERAAKSAGMPKENYTIMHLDLASLDSVRQFVETFRRSERPLDVLVCNAAVYFPTAKEPTYTADGFELSVGTNHLGHFLLSRLLLDDLNKSDYPS 217          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORB_ARATH (Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3)

HSP 1 Score: 287.345 bits (734), Expect = 5.818e-77
Identity = 150/213 (70.42%), Postives = 172/213 (80.75%), Query Frame = 3
Query:   99 VPSAFSVPKEGK---TSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            V SAFSV K+ K   +S+SFKDSSLFG S ++  K++  SS+LR KRE S RN  +RAQT AT+SP V   S  GKKTLRKG+V++TGASSGLGLATAKALAETGKW++IMACRDFLKAERAAKS GM K++YT+MHLDLASLDSVRQFVD FRR+  PLDVLVCNAAVY PTAKEPT++AEGFELSV TNHLGHF          K+SDYPS
Sbjct:    9 VSSAFSVRKDAKLNASSSSFKDSSLFGASITDQIKSEHGSSSLRFKREQSLRNLAIRAQTAATSSPTV-TKSVDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWNVIMACRDFLKAERAAKSVGMPKDSYTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPTAKEPTYSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPS 220          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORC_ARATH (Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.175e-69
Identity = 133/213 (62.44%), Postives = 169/213 (79.34%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQR---NGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PS  S+ KEGK +AS K+++  G SFS H +A+  S+ L  K +  Q+   +  +RAQT+ TA+P  + +SP+ KKT RKG+ +ITGASSGLGLATAKALA+TGKWH+IMACR+FLKAE+AA+S GM+KE+YT+MHLDLASL+SV+QFV+ FRR+ +PLDVLVCNAAVY PTAKEP+FTAEGFE+SVGTNHLGHF          K+SDYPS
Sbjct:   10 LPSTISIQKEGKFNASLKETTFTGSSFSNHLRAEKISTLLTIKEQRRQKPRFSTGIRAQTV-TATPPANEASPEQKKTERKGTAVITGASSGLGLATAKALADTGKWHVIMACRNFLKAEKAARSVGMSKEDYTVMHLDLASLESVKQFVENFRRTEQPLDVLVCNAAVYQPTAKEPSFTAEGFEISVGTNHLGHFLLSRLLLDDLKKSDYPS 221          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORB_HORVU (Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.661e-63
Identity = 126/210 (60.00%), Postives = 152/210 (72.38%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PSA S  KEG      KDS+ FGV  ++  K D +S  LR KR  +  +  +RAQ  A ++P    +SP GKKT+R G+ IITGASSGLGLATAKALAE+GKWH+IMACRD+LK  RAA++AGM K +YTI+HLDLASLDSVRQFV   R+   P+DV+VCNAAVY PTAKEP+FTA+GFE+SVG NHLGHF          K SDYPS
Sbjct:   10 LPSALSARKEGAA----KDSAFFGVRLADGLKLDATSLGLRTKR-VNTSSVAIRAQAAAVSAPTATPASPAGKKTVRTGNAIITGASSGLGLATAKALAESGKWHVIMACRDYLKTARAARAAGMPKGSYTIVHLDLASLDSVRQFVKNVRQLDMPIDVVVCNAAVYQPTAKEPSFTADGFEMSVGVNHLGHFLLARELLEDLKASDYPS 214          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORB_ORYSJ (Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.817e-62
Identity = 127/211 (60.19%), Postives = 153/211 (72.51%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNGVVRAQ-TMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PSA S  KEG    + KDS+  GV   +  K + S+  LR KR  S  +  +RAQ + A +SP V  +SP GK+TLRKG+ +ITGASSGLGLATAKALAETG+WH++M CRDFLKA RAAK+AGM K +YTI+HLDLASLDSVRQFV   RR   P+DV+VCNAAVY PTAK+P+FTA+GFE+SVG NHLGHF            SDYPS
Sbjct:   12 LPSALSARKEG----AVKDSAFLGVRLGDGLKLETSALGLRTKR-VSTSSVAIRAQASAAVSSPTVTPASPSGKQTLRKGTAVITGASSGLGLATAKALAETGRWHVVMGCRDFLKASRAAKAAGMEKGSYTIVHLDLASLDSVRQFVANVRRLEMPVDVVVCNAAVYQPTAKQPSFTADGFEMSVGVNHLGHFLLARELLADLTSSDYPS 217          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORA_ORYSJ (Protochlorophyllide reductase A, chloroplastic OS=Oryza sativa subsp. japonica GN=PORA PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.048e-62
Identity = 126/210 (60.00%), Postives = 144/210 (68.57%), Query Frame = 3
Query:   99 VPSAFSVPKEGKTSASFKDSSLFGVSFSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PSA SVPK+G  SA  K+     VS     KA   S  +R           V       ASP    S   GKKTLR+G V+ITGASSGLGLA AKALAETGKWH++MACRDFLKA  AAK+AGMA  +YT+MHLDLASLDSVRQFVD FRRSG PLD LVCNAA+Y PTA++PTFTA+G+E+SVG NHLGHF          K+SDYPS
Sbjct:   10 LPSALSVPKKGNLSAVVKEPGFLSVS----QKAKKPSLVVRA----------VATPAAPVASPGAGTSKADGKKTLRQGVVVITGASSGLGLAAAKALAETGKWHVVMACRDFLKAATAAKAAGMAAGSYTVMHLDLASLDSVRQFVDNFRRSGMPLDALVCNAAIYRPTARQPTFTADGYEMSVGVNHLGHFLLARLMLDDLKKSDYPS 205          
BLAST of FC868781 vs. ExPASy Swiss-Prot
Match: PORA_HORVU (Protochlorophyllide reductase A, chloroplastic OS=Hordeum vulgare GN=PORA PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.287e-62
Identity = 128/213 (60.09%), Postives = 155/213 (72.77%), Query Frame = 3
Query:   99 VPSAFSVPKEGKT--SASFKDSSLF-GVSFSEHAKADFSSSALRCKREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFXXXXXXXXXXKQSDYPS 728
            +PS  SVPK+G +  + + KD++ F GVS    +KA  +S A+R +        V  A +  T SP    SSP GKKTLR+G V+ITGASSGLGLA AKALAETGKWH++MACRDFLKA +AAK+AGMA  +YT+MHLDLASLDSVRQFVD FRR+  PLDVLVCNAA+Y PTA+ PTFTA+G E+SVG NHLGHF          ++SDYPS
Sbjct:    6 LPSTLSVPKKGSSMGAVAVKDTAAFLGVS----SKAKKASLAVRTQ--------VATAPSPVTTSPGSTASSPSGKKTLRQGVVVITGASSGLGLAAAKALAETGKWHVVMACRDFLKASKAAKAAGMADGSYTVMHLDLASLDSVRQFVDAFRRAEMPLDVLVCNAAIYRPTARTPTFTADGHEMSVGVNHLGHFLLARLLMEDLQKSDYPS 206          
The following BLAST results are available for this feature:
BLAST of FC868781 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
PORA_CUCSA5.993e-9077.62Protochlorophyllide reductase, chloroplastic OS=Cu... [more]
POR_PEA1.025e-8173.46Protochlorophyllide reductase, chloroplastic OS=Pi... [more]
PORA_ARATH1.479e-8072.22Protochlorophyllide reductase A, chloroplastic OS=... [more]
POR_DAUCA1.060e-7871.70Protochlorophyllide reductase, chloroplastic OS=Da... [more]
PORB_ARATH5.818e-7770.42Protochlorophyllide reductase B, chloroplastic OS=... [more]
PORC_ARATH1.175e-6962.44Protochlorophyllide reductase C, chloroplastic OS=... [more]
PORB_HORVU3.661e-6360.00Protochlorophyllide reductase B, chloroplastic OS=... [more]
PORB_ORYSJ1.817e-6260.19Protochlorophyllide reductase B, chloroplastic OS=... [more]
PORA_ORYSJ4.048e-6260.00Protochlorophyllide reductase A, chloroplastic OS=... [more]
PORA_HORVU5.287e-6260.09Protochlorophyllide reductase A, chloroplastic OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004F12EF AbioticL1 Citrus clementina cDNA clone C31004F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868781 ID=FC868781|Name=FC868781|organism=Citrus clementina|type=EST|length=749bp
TCGCCGGGGATTCTCTCAACATTGGTCAGAACAAAAAATCCTTTAGAAAG
AAAGTCTCAACACTAAGCTAGTTAATGGCCCTCCAAGCTGCTGCTTTGGT
TCCCTCTGCTTTCTCAGTCCCCAAAGAGGGTAAAACTAGTGCATCTTTCA
AGGACTCAAGTCTTTTTGGAGTTTCATTCTCAGAACATGCAAAGGCTGAT
TTCAGCTCTTCTGCATTAAGATGCAAGAGAGAATTCAGCCAAAGAAATGG
GGTGGTAAGAGCCCAAACGATGGCTACTGCCTCTCCAGCAGTCGATGTTT
CTTCCCCACAAGGGAAGAAAACTCTCAGAAAAGGCAGCGTTATAATCACC
GGCGCATCGTCTGGATTGGGGCTGGCCACAGCTAAGGCTTTAGCTGAAAC
TGGGAAATGGCATATAATCATGGCCTGCAGGGATTTTCTCAAGGCTGAAA
GAGCCGCCAAGTCGGCTGGCATGGCCAAGGAGAACTACACTATCATGCAT
TTAGATCTGGCTTCCCTTGACAGTGTTCGCCAATTTGTTGATACCTTCAG
GCGATCAGGCAGACCTCTCGATGTGCTAGTTTGCAATGCTGCTGTTTATT
TGCCAACTGCTAAGGAGCCTACATTTACGGCCGAGGGATTTGAACTTAGT
GTTGGAACCAACCATCTTGGTCACTTCCTCCTTTCNACGCTGTTGCTTGA
TGACTTGAAGCAATCTGATTACCCATCAAGCGTCTCATCATCGTTGGCT
back to top