FC868786

Overview
NameFC868786
Unique NameFC868786
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9398 contig Ccv1_Contig9398:1..735. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868786 vs. ExPASy Swiss-Prot
Match: BPS1_ARATH (Protein BPS1, chloroplastic OS=Arabidopsis thaliana GN=BPS1 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.167e-50
Identity = 95/145 (65.52%), Postives = 118/145 (81.38%), Query Frame = 3
Query:  285 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSSPHSLGE 719
            M+RPQDP R FFPFGNPF+ +S K S LS KL+ LL +FE  LA  + KL+PK+K DIL +SWM+ AMESLCETHN IK LIT+LELPVSDW++KW+DVYLDISV LLD+C AFSS LT+++QGHLLLQ  LH L+++SP +L +
Sbjct:    1 MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLASSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSK 145          
BLAST of FC868786 vs. ExPASy Swiss-Prot
Match: U496D_ORYSJ (UPF0496 protein 4 OS=Oryza sativa subsp. japonica GN=Os10g0513300 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.440e-40
Identity = 83/139 (59.71%), Postives = 100/139 (71.94%), Query Frame = 3
Query:  285 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSS 701
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S S
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSES 139          
BLAST of FC868786 vs. ExPASy Swiss-Prot
Match: U496D_ORYSI (UPF0496 protein 4 OS=Oryza sativa subsp. indica GN=OsI_033149 PE=3 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 2.440e-40
Identity = 83/139 (59.71%), Postives = 100/139 (71.94%), Query Frame = 3
Query:  285 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSS 701
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S S
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSES 139          
The following BLAST results are available for this feature:
BLAST of FC868786 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
BPS1_ARATH1.167e-5065.52Protein BPS1, chloroplastic OS=Arabidopsis thalian... [more]
U496D_ORYSJ2.440e-4059.71UPF0496 protein 4 OS=Oryza sativa subsp. japonica ... [more]
U496D_ORYSI2.440e-4059.71UPF0496 protein 4 OS=Oryza sativa subsp. indica GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004G06EF AbioticL1 Citrus clementina cDNA clone C31004G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868786 ID=FC868786|Name=FC868786|organism=Citrus clementina|type=EST|length=732bp
GGAGGACGCAATAGAGTCTCTAACGCGTCTGCGAAATTTCCTAAGATTTT
CGAGTACTGATTTCGGTACGATTTATATCATCTTTTTTTGGTTGTTCTTT
TCTTTAATCTTTGTGAAAAGAGAGGCTATTTTATTTTTCTCTGATTTTTT
TTTTATTTATCAAAGACGTAGAAATTAGGTTTAGTTTTAGTTACGGTCTG
CCATTAATTCTTTGTTAAGTATTTCGATTTAACCGAATAATCAGTTTTTC
GATCCACGATCTATTGCTAAGCAAATCCATCAAAATGAGTCGCCCCCAGG
ATCCACACCGTCCTTTCTTCCCATTTGGAAATCCTTTTCGGATGATGTCC
CCCAAAGGTTCTCGTTTGTCTCCCAAGCTTGTATCTCTGTTGGCTGATTT
TGAGGAGACCTTGGCAGAGAGGCTGAGAAAACTTATGCCGAAAGACAAGG
ATGATATCCTCAACTTATCATGGATGAGACTGGCAATGGAGTCACTTTGT
GAGACTCACAATGTCATAAAAGACCTTATAACTGAGTTGGAGCTTCCTGT
AAGTGACTGGGATGAGAAATGGATAGACGTGTACTTAGACATCAGTGTAA
ACTTGCTTGATATATGCATTGCTTTTAGCTCTGTTCTCACGAAGGTCAGC
CAAGGCCACCTATTGCTTCAGTGTGTCTTGCACACTTTGGATTCTTCCTC
TCCACACAGTTTGGGCGAGCCTGTTCTTCTCT
back to top