FC868794

Overview
NameFC868794
Unique NameFC868794
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:20..744. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 310.071 bits (793), Expect = 7.823e-84
Identity = 161/201 (80.10%), Postives = 173/201 (86.07%), Query Frame = 2
Query:  125 PVLDKSEWVKGQAIR-QSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            PVLD  E++KGQ +R  S   VR  PSG SSLT+RA SYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL++APGLGQY+SGAILFEETLYQSTTDGKKMVDVL+EQ IVPGIKVDKG +PL GSNDESWCQGLDGLA R+AAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:   11 PVLDNPEFLKGQTLRIPSVAGVRFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAA 211          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 300.442 bits (768), Expect = 6.198e-81
Identity = 160/200 (80.00%), Postives = 172/200 (86.00%), Query Frame = 2
Query:  137 KSEWVKGQAI---RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            KS+WVKGQ++   + S+VS       PS+LT+RA S YADELVKTAKT+ASPG GI+AMDESNATCGKRLASIGLENTEANRQAYRTLLV+APGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPL GS DESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:   15 KSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAA 214          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.057e-80
Identity = 160/203 (78.82%), Postives = 176/203 (86.70%), Query Frame = 2
Query:  125 PVLDKSEWVKGQAI--RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            PVLDKSEWVKGQ++  RQ + +   L +  +SLT+RA S YADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLV+APGLGQY+SGAILFEETLYQSTT+GKKMVDVLVEQNIVPGIKVDKGLVPL GSN+ESW QGLDGL+SRTAAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:   11 PVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAA 213          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 3.520e-76
Identity = 145/170 (85.29%), Postives = 155/170 (91.18%), Query Frame = 2
Query:  215 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            LTIRAGSYADELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTE NRQA+RTLLVT P LG+YISGAILFEETLYQSTTDG+K+VDVL+EQNI+PGIKVDKGLVPLAGSNDESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:    2 LTIRAGSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAA 171          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 283.878 bits (725), Expect = 6.004e-76
Identity = 152/197 (77.16%), Postives = 162/197 (82.23%), Query Frame = 2
Query:  137 KSEW-VKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            KSEW    QA     V+V        S+ +RAG+Y DELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQST DGKK+VD+L EQ IVPGIKVDKGLVPLAGSN+ESWCQGLDGLASR AAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:   15 KSEWGATRQAAAPKPVTV--------SMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNGPSELAVKEAAWGLARYAA 203          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.361e-72
Identity = 139/165 (84.24%), Postives = 149/165 (90.30%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            GSYADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLVT P LG+YISGAILFEETLYQST DG+K+VDVLVEQNI+PGIKVDKGLVPLAGSN+ESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP        ++   G ARYAA
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPSALAVKEAAWGLARYAA 165          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 9.284e-69
Identity = 135/195 (69.23%), Postives = 155/195 (79.49%), Query Frame = 2
Query:  140 SEWVKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPL-GSARYAA 721
            S W+  ++   ++ S  S P    S  IRAG+Y+DELVKTAK++ASPGRGILA+DESNATCGKRLASIGL+NTE NRQAYR LL+T PGLG YISG+ILFEETLYQST DGK  VD L + NIVPGIKVDKGL PLAGSN+ESWCQGLDGLASR+A YY+QGARFAKWRTVVS+P        ++   G ARYAA
Sbjct:   14 SPWIGQRSFAHTSAS--SSPPPRVSFAIRAGAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVPCGPSALAVKEAAWGLARYAA 206          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.258e-57
Identity = 120/164 (73.17%), Postives = 128/164 (78.05%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPMAHLPWQSRKPLGSARYAA 721
            G Y +EL+KTA TVAS GRGILAMDESNATCGKRL SIG+ENTE NR+AYR LLVTAPGLGQYISGAILFEETLYQST  GKK VDV+ EQNIVPGIKVDKGLVP   +   SWC GLDG  S  A YY+ GARFAKWR+VVSIP        R   G ARYAA
Sbjct:   28 GKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTS-AAEYYKAGARFAKWRSVVSIPHGPSIMLPRLAYGLARYAA 189          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 3.795e-46
Identity = 91/142 (64.08%), Postives = 107/142 (75.35%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            Y DEL+KTAK +A+PGRGILA DES  T GKR A I +ENTE+NRQAYR LL T+PG    +SG ILFEETLYQ T+DGK  VD+L+E  ++PGIKVDKGLV LAG+N E+  QGLD L +R   YY+ GARFAKWR    I
Sbjct:    8 YEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKI 149          
BLAST of FC868794 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.455e-46
Identity = 89/144 (61.81%), Postives = 110/144 (76.39%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 661
            G YADEL+K AK +A+PG+GILA DES  T GKRLASI +EN EANRQA R LL T+P   QY+SG ILFEETLYQ +++GK  V++L E N++PGIKVDKG+V LAG++ E+  QG D L +R   YY+ GARFAKWR V+ I
Sbjct:    6 GKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKI 149          
The following BLAST results are available for this feature:
BLAST of FC868794 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_SPIOL7.823e-8480.10Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC1_ARATH6.198e-8180.00Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC2_ARATH1.057e-8078.82Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA3.520e-7685.29Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC_ORYSJ6.004e-7677.16Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA2.361e-7284.24Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH9.284e-6969.23Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE1.258e-5773.17Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_ARATH3.795e-4664.08Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA8.455e-4661.81Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004H03EF AbioticL1 Citrus clementina cDNA clone C31004H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868794 ID=FC868794|Name=FC868794|organism=Citrus clementina|type=EST|length=723bp
AAAGATAGTGCAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCGAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCAACAGGGAGCTCGTTTCGCCAAATGGCGTACTG
TTGTGAGCATTCCCATGGCCCATCTGCCTTGGCAGTCAAGGAAGCCGCTG
GGGTCTGCCCGCTATGCTGCCAT
back to top