FC868795

Overview
NameFC868795
Unique NameFC868795
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868795_ssr235 microsatellite FC868795_ssr235:235..246. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15128 contig Ccv1_Contig15128:71..753. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_PHANO (DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum GN=DDI1 PE=3 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.370e-15
Identity = 54/190 (28.42%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  142 ADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNN-AEKLSALGVKDEDLVMMVSN---------AASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            +D ++++L++ P  TV+++K  +E ET +P   Q +  NG+ ++   + L  +G++D +++ ++           AAS PA       P G + +P A +Q +  +  +  +L Q DPEL  ++  ND ++ ++                   +ALL  DPF+VEAQ+KIE  IRQ+ + EN   A   N
Sbjct:   15 SDGELLTLELPPGSTVKDLKGFIEAETNLPAASQGIYLNGQPVSQETQTLENVGIRDGEMLAVIVRQNRQQPQQPAASRPA-------PVGQS-DPEAVRQQVLRNPQVQAELRQRDPELLAIM--NDADRWREAFASRQNSAQNAERERQNQIALLNEDPFNVEAQRKIEDIIRQERVVENLEKAYNEN 194          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_CHAGB (DNA damage-inducible protein 1 OS=Chaetomium globosum GN=DDI1 PE=3 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.546e-14
Identity = 58/191 (30.37%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  145 DEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMN-NAEKLSALGVKDEDLVMM-VSNAASSPATNNLSFNPDGSAVNPAA----------FQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            D++++SL+V P  T+E +++ ++ ET      Q L +NG+ ++ NA+ L  LGV D D++ + + +   S  T   +     SA  PAA           +  I  D NL  +L +S P+L   L   D  +                      + LL ADPFD++AQ +IE  IRQ+ + EN   A+EHN
Sbjct:   16 DQELLSLEVYPEMTIETLRSSIQAETTHHPSAQHLYHNGQLVHDNAKTLGELGVTDGDMLALHIRDMRGSTTTPAAARAAPQSAARPAARPPPAQDPEVIRLQILGDPNLRGELGRSRPDLVAAL--EDPQRFARLFADSLDRERRERNERQRQIQLLNADPFDIDAQARIEEIIRQERVMENLQNAMEHN 204          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_NEOFI (DNA damage-inducible protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ddi1 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.727e-13
Identity = 52/180 (28.89%), Postives = 88/180 (48.89%), Query Frame = 1
Query:  184 TVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDL--VMMVSNAASSPATNNLSFNPDGSAV-----------NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            TVE +KA++E ET +P   Q+L+YN + + N+A+ L  +G+ + D+  V +   +  +PA  ++   P  +A            +P   + HI  D  +   + + +PELA     ND  + +D                   +A+L ADPF+ E Q++IE  IRQ  + EN   A+EH+
Sbjct:    2 TVELLKAIVESETSIPTNNQRLVYNNQLLGNDAQTLEQIGIGEGDMLGVHVTMRSPQAPA-RSIGGGPSAAAQQNLQRRQPMTPDPETIRLHILGDPRVREAVRRQNPELADA--ANDAQRFRDVLMAQQRREAQMEAEKEARIAMLNADPFNPENQREIEEIIRQNAVTENLHTAMEHH 178          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI2_XENTR (Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.026e-13
Identity = 61/209 (29.19%), Postives = 96/209 (45.93%), Query Frame = 1
Query:  148 EQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDLVMM-----------------------VSNAASSPATNNLSFNP----DGSAV-----NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALE 675
            E   SL+VD    +EN +AL E+E+ +P  +  ++Y  R + NN   L++ G+KD D+V++                       V  ++S PA +     P    D S+      NPA  ++ +  + + ++ L + +P LA+ LL  DL K                      + L  ADPFD+EAQ KIE  IRQ+ I+EN   A+E
Sbjct:   14 EVTFSLEVDGDFELENFRALCELESGIPASETLIVYAERPLTNNQRSLASYGLKDGDVVILRQRETPEARPAAPFPGLDFSTIAVPGSSSQPAPSQPQAPPPPPPDTSSFPQGLDNPALLREMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLLEQQQERARREQER---IRLYSADPFDLEAQAKIEEDIRQQNIEENMTIAME 219          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_ASPFU (DNA damage-inducible protein 1 OS=Aspergillus fumigatus GN=ddi1 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.573e-13
Identity = 51/180 (28.33%), Postives = 87/180 (48.33%), Query Frame = 1
Query:  184 TVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDL--VMMVSNAASSPATNNLSFNPDGSAV-----------NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            TVE +KA++E ET +P   Q+L+YN + + N+A+ L  +G+ + D+  V +   +  +PA  ++   P  +A            +P   + HI  D  +   + + +PELA      D  + +D                   +A+L ADPF+ E Q++IE  IRQ  + EN   A+EH+
Sbjct:    2 TVELLKAIVESETSIPTNNQRLVYNNQLLGNDAQTLEQIGIGEGDMLGVHVTMRSPQAPA-RSIGGGPSAAAQQNLQRRQPMTPDPETIRLHILGDPRVREAVRRQNPELADA--ATDAQRFRDVLMAQQRREAQMEAEKEARIAMLNADPFNPENQREIEEIIRQNAVTENLHTAMEHH 178          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_ASPCL (DNA damage-inducible protein 1 OS=Aspergillus clavatus GN=ddi1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.258e-12
Identity = 49/179 (27.37%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  184 TVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAV------------NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            +VE +KA++E ET +P   Q+L+YN + + N+++ L  +G+ + D+ + V     SP     S  P  +A             +P   + HI  D  +   + + +PELAQ    +D ++ ++                   +A+L +DPF+ E Q++IE  IRQ  + EN   A+EH+
Sbjct:    2 SVELLKAIVESETSIPANTQRLVYNNQLLGNDSQTLEQIGIGEGDM-LGVHVTLRSPQAPARSVGPPSTAAQQNLQRRQAAAPDPETIRLHILGDPRVREAVRRQNPELAQA--ADDAHRFREVLMAQQRREAQLEAEKEARIAMLNSDPFNPENQREIEEIIRQNAVTENLHTAMEHH 177          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI2_XENLA (Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-12
Identity = 60/208 (28.85%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  148 EQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDLVMMVSNAA--------------SSPATNNLSFNPDGSAV-----------------NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALE 675
            E   SL+VD    +EN +AL E+E+ +P     ++Y  R + +N   L++ G+KD D+V++    A              S+ A    S  PD S                   NPA  +Q +  + + ++ L + +P LA+ LL  DL K                      + L  ADPFD++AQ KIE  IRQ  I+EN   A+E
Sbjct:   14 EITFSLEVDGDFELENFRALCELESGIPASDTLIVYAERPLTDNQRSLASYGLKDGDVVILRQKEAPETRPAAPFPGLDFSTIAVPGASSQPDPSQPQAPPPPPDTSSFPQGLDNPALLRQMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLQEQQQERARREQER---IRLYSADPFDLDAQAKIEEDIRQHNIEENMTIAME 218          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_DICDI (Protein DDI1 homolog OS=Dictyostelium discoideum GN=ddi1 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-12
Identity = 50/198 (25.25%), Postives = 85/198 (42.93%), Query Frame = 1
Query:  127 ITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNN-------------LSFNPDGSAVN-PAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEH 678
            IT+   +E  I +++ P +TVE++K  +E ET + +  Q L  +G+ ++N +KLS   +K  D +++  N   +P   +                 P    +N P     H  N+   +TQ+  S+P LA  +L  D+  L                       L   DP+  E QK     I+Q+ I++N   A+EH
Sbjct:    4 ITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQVLTLDGKVLDNEKKLSDYSIKGGDFLLITKNVLRAPQQRSQQPQQPQQPQQPQQQRQPQRDPLNSPQDILDHFTNNPEDLTQVINSNPALANAILSKDMKFL--------THFVEQIKEQRRIQELALKDPYGEEYQKLAYQHIQQQNIEKNMQHAMEH 193          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_ASPOR (DNA damage-inducible protein 1 OS=Aspergillus oryzae GN=ddi1 PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 9.479e-12
Identity = 49/179 (27.37%), Postives = 83/179 (46.37%), Query Frame = 1
Query:  184 TVENVKALLEVETQVPLQQQQLLYNGREM-NNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAV------------NPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            TVE +KA++E ET VP   Q+++YN + + ++A  L  +G+ + D++ +     S  A    +  P   A             +P   + HI  D  +   + + +PELA     +D  + +D                   +A+L ADPF+ E Q++IE  IRQ  + EN   A+EH+
Sbjct:    2 TVELLKAIVESETSVPPSAQRIVYNNQLLGDDARTLEQVGIGEGDMLGVHVTLRSPQAPTRTAGGPSAPAAQQNLQRRQAMNPDPETIRLHILGDPRVREAVRRQNPELADA--ASDAQRFRDVFLNQQRREAQLEAEKEARIAMLNADPFNPENQRQIEEIIRQNAVTENLHNAMEHH 178          
BLAST of FC868795 vs. ExPASy Swiss-Prot
Match: DDI1_YARLI (DNA damage-inducible protein 1 OS=Yarrowia lipolytica GN=DDI1 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.617e-11
Identity = 56/206 (27.18%), Postives = 96/206 (46.60%), Query Frame = 1
Query:  121 MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEK---LSALGVKDEDLVMMVS-------NAASSPATNNLSFN-------PDGSAVNPAAFQ--QHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHN 681
            M+I V T  E +  L+V      E++ A +E+E  VP +   L  NG  + + +    + +LGV D  ++++ +       + ++ PA   L F+       P    V+P A Q    I   A+ + QL  S+PELA+ +  +D  K  D                   +  LYADP + + QK+I   IRQ+ ++E++  A+EH+
Sbjct:    1 MQIFVTTPSENVFGLEVAADMAYEDLLAFVEMEASVPSKDIILSLNGNPIVDTDPKATIGSLGVTDNSMLLLTTKRVAPNPSTSAQPAIPTLDFSSIQIPGLPAAQRVDPRAEQIRTQILERADSLDQLKLSNPELAEHV--HDSQKFSDAFTKLQNELRAKEVERKKELQRLYADPDNEDNQKRIMEIIRQENVEESYQNAMEHH 204          
The following BLAST results are available for this feature:
BLAST of FC868795 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
DDI1_PHANO5.370e-1528.42DNA damage-inducible protein 1 OS=Phaeosphaeria no... [more]
DDI1_CHAGB4.546e-1430.37DNA damage-inducible protein 1 OS=Chaetomium globo... [more]
DDI1_NEOFI1.727e-1328.89DNA damage-inducible protein 1 OS=Neosartorya fisc... [more]
DDI2_XENTR5.026e-1329.19Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=dd... [more]
DDI1_ASPFU8.573e-1328.33DNA damage-inducible protein 1 OS=Aspergillus fumi... [more]
DDI1_ASPCL3.258e-1227.37DNA damage-inducible protein 1 OS=Aspergillus clav... [more]
DDI2_XENLA5.557e-1228.85Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 P... [more]
DDI1_DICDI5.557e-1225.25Protein DDI1 homolog OS=Dictyostelium discoideum G... [more]
DDI1_ASPOR9.479e-1227.37DNA damage-inducible protein 1 OS=Aspergillus oryz... [more]
DDI1_YARLI1.617e-1127.18DNA damage-inducible protein 1 OS=Yarrowia lipolyt... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004H04EF AbioticL1 Citrus clementina cDNA clone C31004H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868795 ID=FC868795|Name=FC868795|organism=Citrus clementina|type=EST|length=683bp
GACCTTCTTCACAACGAAAACTGAGAAAGCAAAGCACTATTTATAAGCCC
AAATCAAAACAATCAAAAAGTCACAAGGTTCCAAGTAAAATAGAGAGATC
CAATCTGAAGGAGACACAAGATGAGGATTACTGTAATGACTGCAGATGAA
CAGATCATCAGCTTGGACGTTGACCCACATGAAACTGTTGAAAACGTGAA
AGCTTTGCTCGAAGTGGAGACACAGGTGCCGCTTCAGCAGCAGCAGCTGC
TTTACAATGGGAGGGAGATGAATAATGCTGAAAAATTGAGTGCATTGGGT
GTTAAAGATGAGGATTTGGTGATGATGGTCTCTAATGCTGCATCCAGTCC
AGCAACCAATAACTTGAGCTTCAATCCAGATGGGTCTGCTGTCAACCCTG
CGGCTTTCCAGCAGCACATTCGAAATGATGCTAATCTTATGACTCAACTG
TTTCAGAGTGATCCTGAATTAGCTCAAGTTCTCCTTGGAAACGATCTCAA
TAAGCTGCAGGACCTATTAAGAGAGCGTAGTCGTCAAAGGTCTGAGTTAC
GGCGTCGACAGGAAGAGGAGATGGCGCTTCTTTATGCAGATCCTTTTGAT
GTTGAAGCACAAAAGAAAATTGAAGCTGCCATTCGCCAGAAAGGAATTGA
TGAGAACTGGGCAGCTGCCTTGGAACATAACCC
back to top